PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G247900.1
Common NameB456_005G247900, LOC105795349
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 327aa    MW: 36158.9 Da    PI: 6.0696
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G247900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.57.5e-18244277134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  Gorai.005G247900.1 244 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 277
                         *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169927.0E-775322IPR016679Transcription factor, GATA, plant
SMARTSM004014.2E-14238292IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.33E-13240301No hitNo description
PROSITE profilePS5011411.332242274IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.9E-14242276IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.43E-13243294No hitNo description
PfamPF003209.6E-16244277IPR000679Zinc finger, GATA-type
PROSITE patternPS003440244269IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MELCMEAKAL KSSVRGEFTK NSHNQNQHVA FDDFFSSNGG VSSEEFSVDC FFDFTNGEFE  60
EENEEKNSAL IFSQEERVTD DDSNSNSSSF SFDSGLTNEL SVPDDEIAGL EWVSQFVDDS  120
FPVLPFSCPV FKQQAENQPE ARFEPESAPV FVKTPCFSSP IPSKSRSKRA KPTGKTWPFG  180
SFSRFESSTS STTTASSSST SSGFSISSTP TQKPNLGDII EPPTKKQRRK SVVQSNGNAF  240
QRRCSHCQVQ KTPQWRTGPL GAKTLCNACG VRYKSGRLYP EYRPACSPTF SGDMHSNSHR  300
KVLEMRKKKE LAGKEPDELT PVVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480390.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLA0A0D2NI240.0A0A0D2NI24_G
STRINGPOPTR_0009s12620.15e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57392647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-39GATA transcription factor 5
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]