PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G241600.2
Common NameB456_005G241600, LOC105795283
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 371aa    MW: 41429.7 Da    PI: 8.6302
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G241600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.13.8e-082372831763
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         A+rsR RK+++i+eLe+ v++L+ae ++   ele l+++   l +e+
  Gorai.005G241600.2 237 AQRSRVRKLQYIAELERNVQALQAEGSEVSAELEFLNQQNLILSMEN 283
                         89***********************************9998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.6E-4226285IPR004827Basic-leucine zipper domain
CDDcd147031.98E-15230276No hitNo description
SuperFamilySSF579597.03E-6237279No hitNo description
Gene3DG3DSA:1.20.5.1705.3E-8237279No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MANSKGSTNI RNFMVSGKHA LLPPKSPFPT VSPAYTDYVP NSVIGSKAVQ KPREGNTHHQ  60
RTSSESLRME EQPSWLDDLL NEPETPVRRG GHRRSSSDSF AYIDASNSPN LDYAAQDEFR  120
YQNMINTPSW ASQDARLSSL YSDVNLVKQN RAWDSSLNVM THPSRLPSLR ENTFLQSLGS  180
SCAPRELEGA LSTASEKQDS AESPPPDAKA SSEKKDNSHT KSSTCDGDSK RAKQQFAQRS  240
RVRKLQYIAE LERNVQALQA EGSEVSAELE FLNQQNLILS MENKALKQRL EGLAQEKAIK  300
HFEQEVLERE LSRLRALYQQ QQNQPQQQQQ LSSTHRRSSS RDLDSQFANL SLNNKDANSG  360
STPVTGPLRI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480294.10.0PREDICTED: uncharacterized protein At4g06598
SwissprotQ8W3M71e-75Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLA0A0D2RSJ70.0A0A0D2RSJ7_G
STRINGGLYMA05G30170.31e-171(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.22e-96bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]