PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G237400.3
Common NameB456_005G237400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 378aa    MW: 40355.5 Da    PI: 8.4586
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G237400.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.91.2e-14328371548
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                         +r++r++kNRe+A rsR+RK+a++ eLe +v++L++ N++L k+
  Gorai.005G237400.3 328 RRQKRMIKNRESAARSRARKQAYTLELEAEVAKLKEMNQELLKK 371
                         79*************************************88764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-8324376IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.289326371IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.8E-13328371No hitNo description
PfamPF001705.4E-12328371IPR004827Basic-leucine zipper domain
CDDcd147072.21E-25328373No hitNo description
SuperFamilySSF579596.13E-10328371No hitNo description
PROSITE patternPS000360331346IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MEFIGQFDCG HNILLLWKMG SHLNFKNFGG DGNNGSKPVV NSPLVRQSSI YSLTFDELQS  60
TFGGLGKDFG SMNMDELLRN ISTAEETQSA MTASVSAGEG GDVSGGNLQK QGSLSLPRTL  120
SQKTVDEVWK YLMKESDGGS NDGSTGGEAN LPQRQQTLGT MTLEEFLARA GVVREDMQQI  180
GMVNNGGFFA DNSPLALGFQ QANTNNGFAS GVKSSSQLQQ QPQPLFPKQQ VVAFAPPMHL  240
MNATQLASPG AKGSVVGIGD PSMNNNLVQN TGLQGGGMGI VGLGSPASQI SSDVVSKNSI  300
DTTSPSPVPY IFGRGRKCGA NLEKVVERRQ KRMIKNRESA ARSRARKQAY TLELEAEVAK  360
LKEMNQELLK KQVPIIC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480228.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 isoform X3
SwissprotQ9M7Q31e-105AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A0D2RS810.0A0A0D2RS81_G
STRINGPOPTR_0009s10400.11e-132(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.26e-79abscisic acid responsive elements-binding factor 3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]