PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G237400.2
Common NameB456_005G237400, LOC105795245
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 389aa    MW: 41969.4 Da    PI: 9.8989
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G237400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.92.5e-14310362557
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         +r++r++kNRe+A rsR+RK+a++ eLe +v++L++ N++L k+ ee  ++ +
  Gorai.005G237400.2 310 RRQKRMIKNRESAARSRARKQAYTLELEAEVAKLKEMNQELLKKQEEVMEMQK 362
                         79****************************************99999988865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-12306371IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.461308359IPR004827Basic-leucine zipper domain
PfamPF001701.9E-12310362IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-9310359No hitNo description
Gene3DG3DSA:1.20.5.1706.6E-13310360No hitNo description
CDDcd147072.59E-25310364No hitNo description
PROSITE patternPS000360313328IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGSHLNFKNF GGDGNNGSKP VVNSPLVRQS SIYSLTFDEL QSTFGGLGKD FGSMNMDELL  60
RNISTAEETQ SAMTASVSAG EGGDVSGGNL QKQGSLSLPR TLSQKTVDEV WKYLMKESDG  120
GSNDGSTGGE ANLPQRQQTL GTMTLEEFLA RAGVVREDMQ QIGMVNNGGF FADNSPLALG  180
FQQANTNNGF ASGVKSSSQL QQQPQPLFPK QQVVAFAPPM HLMNATQLAS PGAKGSVVGI  240
GDPSMNNNLV QNTGLQGGGM GIVGLGSPAS QISSDVVSKN SIDTTSPSPV PYIFGRGRKC  300
GANLEKVVER RQKRMIKNRE SAARSRARKQ AYTLELEAEV AKLKEMNQEL LKKQEEVMEM  360
QKNQMLEKVN RPWGRKRRCL RRTITCPW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480227.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 isoform X2
SwissprotQ9M7Q31e-122AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A0D2PYJ00.0A0A0D2PYJ0_G
STRINGPOPTR_0009s10400.11e-149(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.24e-97abscisic acid responsive elements-binding factor 3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]