PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G211900.3
Common NameB456_005G211900, LOC105794977
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TCP
Protein Properties Length: 258aa    MW: 26592.8 Da    PI: 10.1465
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G211900.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP124.41.2e-3829114288
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                         a+kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as++ ++s s  ++ns+s 
  Gorai.005G211900.3  29 AVKKPPTKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFS-TVSVSLRGANSTSL 114
                         78**************************************************************99999777.33333333322222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-3335119IPR005333Transcription factor, TCP
PROSITE profilePS5136928.2873589IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MSNSETAATN GSLMDPQRHQ APAANGSLAV KKPPTKDRHS KVDGRGRRIR MPIICAARVF  60
QLTRELGHKS DGQTIEWLLR QAEPSIIAAT GTGTTPASFS TVSVSLRGAN STSLSSTTSS  120
SLDHKPLLGP TPFILGKRVR SDDDNAGKDD SGGLTVGPGV GSIVGPNGTH PGGFWALPAR  180
PDFGQLWSFA APPPPDMVVQ AAAQQPAAAA ALFVQQQQAM GEASAARVGN YLPGHLNLLA  240
SLSGAPGGSG RRDEDPH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479842.10.0PREDICTED: transcription factor TCP21
RefseqXP_012479843.10.0PREDICTED: transcription factor TCP21
RefseqXP_012479844.10.0PREDICTED: transcription factor TCP21
SwissprotQ9FMX23e-95TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A0D2SKJ20.0A0A0D2SKJ2_GOSRA; Uncharacterized protein
STRINGGorai.005G211900.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.12e-68TCP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]