PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G198500.3
Common NameB456_005G198500, LOC105794834
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family VOZ
Protein Properties Length: 452aa    MW: 50381.4 Da    PI: 5.0553
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G198500.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ440.12.9e-1352004161217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwn 91 
                         pppsaf+gpkcalwdctrpaqgs+w+qdycssfhatlalne++pgttp+lrp+gi+lkd+ll++a++ak+qgk+vgip+cegaat+kspwn
  Gorai.005G198500.3 200 PPPSAFMGPKCALWDCTRPAQGSDWFQDYCSSFHATLALNEDPPGTTPILRPGGISLKDNLLLDAVRAKAQGKNVGIPQCEGAATMKSPWN 290
                         89***************************************************************************************** PP

                 VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalal 182
                         a+elfdlsllege irewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkef+g+krsyymdpqps+++ewhl+eyei+ +da+al
  Gorai.005G198500.3 291 ATELFDLSLLEGEIIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKEFAGQKRSYYMDPQPSGKYEWHLFEYEIYGCDAFAL 381
                         ******************************************************************************************* PP

                 VOZ 183 yrlelklvdekksakgkvskdsladlqkklgrlta 217
                         yrlelkl+++kks+k+kv kdsladlqkk+grlta
  Gorai.005G198500.3 382 YRLELKLANQKKSPKAKVPKDSLADLQKKMGRLTA 416
                         *********************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MQNNSSKNKC SSASHQQMVD NAKNRLNFLQ DQFTDLQAAR KEGRAGDVAV LEEQVYQNLR  60
EWKAELCTPS PASSLLGSLG SFSDDINRLL QLYEEEDDAT SPLKEPAVLK PEIDDQSLNP  120
STLPVIPEDY FVTHEPQEQS FQGFDLCKVS TSANADINYQ LDYHPFDLQQ DFDHEHLLDA  180
NGTEDYVKDA NSNMLPNISP PPSAFMGPKC ALWDCTRPAQ GSDWFQDYCS SFHATLALNE  240
DPPGTTPILR PGGISLKDNL LLDAVRAKAQ GKNVGIPQCE GAATMKSPWN ATELFDLSLL  300
EGEIIREWLF FDKPRRAFES GNRKQRSLPD YSGRGWHESR KQVMKEFAGQ KRSYYMDPQP  360
SGKYEWHLFE YEIYGCDAFA LYRLELKLAN QKKSPKAKVP KDSLADLQKK MGRLTAEVPG  420
DDKPPGKGKT KANKKAAMAA AAAANVNSAQ D*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1660929e-35AC166092.4 Glycine max cultivar Williams 82 clone gmw1-93l19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479644.10.0PREDICTED: transcription factor VOZ1-like isoform X2
RefseqXP_012479645.10.0PREDICTED: transcription factor VOZ1-like isoform X2
SwissprotQ9SGQ01e-177VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0D2SKF60.0A0A0D2SKF6_GOSRA; Uncharacterized protein
STRINGGorai.005G198500.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-165vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  4. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  5. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]