PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G195400.1
Common NameB456_005G195400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 163aa    MW: 18127.7 Da    PI: 9.8526
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G195400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM34.84.8e-111554141
                 NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiyk 41
                        lp GfrFhPtdeelvv+yL +kv + +l++ ++i+ev i+k
  Gorai.005G195400.1 15 LPHGFRFHPTDEELVVQYLGRKVLAWPLPA-SIIPEVMITK 54
                        699************************999.7899998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-12852IPR003441NAC domain
PfamPF023652.6E-816116IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MMGKLNFVIN GVLRLPHGFR FHPTDEELVV QYLGRKVLAW PLPASIIPEV MITKQILGTC  60
QNHVVAVENW VLCRIFLKKR SGGATKNEDG SLQSSNEKGV GKARRKSPVF YEFLSKERTN  120
LNPAPTSSSS CSSGITRVSN NDTDDHEESS SCNSFPYFRR KP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.28641e-115flower|seedling| flowering
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1106421e-114KC110642.1 Gossypium hirsutum NAC protein 7 (NAC7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016666241.13e-56PREDICTED: NAC domain-containing protein 83-like
RefseqXP_017643855.13e-56PREDICTED: NAC domain-containing protein 83-like
TrEMBLA0A0D2NEI01e-117A0A0D2NEI0_GOSRA; Uncharacterized protein
STRINGGorai.005G195400.11e-118(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.14e-19NAC domain containing protein 83
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]