PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G142300.1
Common NameB456_005G142300, LOC105794206
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 287aa    MW: 33012.3 Da    PI: 8.5192
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G142300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.61.4e-5491341128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yLk+++++k++++ ++i+evdiyk++Pw+Lp k++ +ekewyfFs+rd+ky++g r+nrat sgyWkatg+dk+
  Gorai.005G142300.1   9 LPPGFRFHPTDEELITFYLKNQAKSKPCPV-SIIPEVDIYKFDPWQLPDKAEFGEKEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKA 98 
                         79****************************.89***************99999************************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s +++ vg+kk Lvfykg+ pkg ktdW+mheyrl
  Gorai.005G142300.1  99 IYS-GSKYVGVKKALVFYKGKPPKGLKTDWIMHEYRL 134
                         ***.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-665161IPR003441NAC domain
PROSITE profilePS5100561.2059161IPR003441NAC domain
PfamPF023654.3E-2710134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
METKTSSDLP PGFRFHPTDE ELITFYLKNQ AKSKPCPVSI IPEVDIYKFD PWQLPDKAEF  60
GEKEWYFFSP RDRKYPNGVR PNRATVSGYW KATGTDKAIY SGSKYVGVKK ALVFYKGKPP  120
KGLKTDWIMH EYRLNDSRKQ ITKQNGSMRL DDWVLCRIYK KKNSGGRGLD QQVEESNTPI  180
HMTQCSNDAS ETQQMLKFPR TNSSVPQLLE LDYMGPISQL LGENTYNSSF DYFPNTIASN  240
TTGDHVEKLQ LQEIPCQYTD SGKLQVNENG FLNQQVYMNP MLYQFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-72516513169NO APICAL MERISTEM PROTEIN
1ut4_B6e-72516513169NO APICAL MERISTEM PROTEIN
1ut7_A6e-72516513169NO APICAL MERISTEM PROTEIN
1ut7_B6e-72516513169NO APICAL MERISTEM PROTEIN
3swm_A7e-72516516172NAC domain-containing protein 19
3swm_B7e-72516516172NAC domain-containing protein 19
3swm_C7e-72516516172NAC domain-containing protein 19
3swm_D7e-72516516172NAC domain-containing protein 19
3swp_A7e-72516516172NAC domain-containing protein 19
3swp_B7e-72516516172NAC domain-containing protein 19
3swp_C7e-72516516172NAC domain-containing protein 19
3swp_D7e-72516516172NAC domain-containing protein 19
4dul_A6e-72516513169NAC domain-containing protein 19
4dul_B6e-72516513169NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2038950.0KP203895.1 Gossypium hirsutum putative NAC transcription factor (SNAC1) mRNA, complete cds.
GenBankKP3000080.0KP300008.1 Gossypium hirsutum cultivar CCRI10 NAP (NAP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478708.10.0PREDICTED: NAC transcription factor 29-like
SwissprotK4BNG71e-117NAP2_SOLLC; NAC domain-containing protein 2
TrEMBLA0A0D2SGT90.0A0A0D2SGT9_GOSRA; Uncharacterized protein
STRINGGorai.005G142300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77072641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-114NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]