PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G141200.1
Common NameB456_005G141200, LOC105796163
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 387aa    MW: 43032.9 Da    PI: 7.2495
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G141200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.51.1e-52151421128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         + pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++
  Gorai.005G141200.1  15 MLPGFRFHPTDEELVGFYLKRKIQQRPLSV-ELIKQLDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRP 104
                         579***************************.89***************8888999************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+ +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  Gorai.005G141200.1 105 IYSSeGSKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 142
                         ***956677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5813175IPR003441NAC domain
PROSITE profilePS5100557.06415175IPR003441NAC domain
PfamPF023651.2E-2517142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MDERVSDSDK MEEIMLPGFR FHPTDEELVG FYLKRKIQQR PLSVELIKQL DIYKYDPWDL  60
PKLATTGEKE WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPIYSSEG SKCIGLKKSL  120
VFYKGRAAKG VKTDWMMHEF RLPSLTDSAA TPPKRFLDKC LPANDSWAIC RIFKKTNSTA  180
QRALCHSWVS PIPETSSISD MLRGSDTPQL SSDNISLTPK TSSSPVQFNL ISNTDLLQAS  240
SAAFSPLDFV PYKPLSQMAP QLPISNGDLT SLIFAPLDQT PSPAKSAVDV TSVLLNMSSS  300
MLGEYDSTVH FHGGSQDHCN GFSSGTLPHG IQGNMVINNE DHENALLKNL NVTHVDDQWD  360
GIRSIGFPFS LPLPMSVADA WKPSMP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-5451826171NO APICAL MERISTEM PROTEIN
1ut4_B1e-5451826171NO APICAL MERISTEM PROTEIN
1ut7_A1e-5451826171NO APICAL MERISTEM PROTEIN
1ut7_B1e-5451826171NO APICAL MERISTEM PROTEIN
4dul_A1e-5451826171NAC domain-containing protein 19
4dul_B1e-5451826171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at globular stage onward in the COL progenitors after the first division of the hypophyseal cell. Later observed in these cells and their descendants, mostly in direct daughter cells. Also detected in the Epi/LRC stem cells and daughters, and is retained in maturing LRC layers. Present in elongated stem cells that are about to divide. {ECO:0000269|PubMed:19081078}.
UniprotTISSUE SPECIFICITY: Expressed in root cap stem cells and their immediate daughters. {ECO:0000269|PubMed:19081078}.
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472270.0KC847227.1 Gossypium hirsutum NAC domain protein NAC50 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313927.10.0protein FEZ-like
RefseqXP_012481219.10.0PREDICTED: protein FEZ-like
SwissprotQ9ZVH01e-118FEZ_ARATH; Protein FEZ
TrEMBLA0A0D2SGR30.0A0A0D2SGR3_GOSRA; Uncharacterized protein
TrEMBLW6J8Y60.0W6J8Y6_GOSHI; NAC domain protein NAC50
STRINGGorai.005G141200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-120NAC family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]