PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G111000.4
Common NameB456_005G111000, LOC105793819
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 570aa    MW: 62572.1 Da    PI: 6.9348
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G111000.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.36.7e-13406464563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr +r   NR +A rs qRK ++i+eLe+kv++L++e ++L  +l +l+  +a+l+s++
  Gorai.005G111000.4 406 KRVKRILANRQSAARSKQRKMQYIAELEQKVQTLQTEATTLSAQLTMLQRDSAELTSQN 464
                         8999****************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.6E-19402466IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.323404467IPR004827Basic-leucine zipper domain
PfamPF001709.6E-11406464IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-12406463No hitNo description
SuperFamilySSF579598.75E-12406462No hitNo description
CDDcd147034.22E-24407458No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MKMEGSNSIP KPQSNLDIPF SNASQMASPS PSSSPSPSPS YMRLSPENNN SKRPGIPPSH  60
PNNPTASLPY SQQIIGSRPN AQHGAPSHSR SLSQPTFFSL DRLPPWCPPP YRDPPVSSAS  120
DPASNDVSME ERFANSNVRF SLPSPVAGGC NEFRIGESSS LPPRKGHRRS SSDVPLGFST  180
MIQSLPQSIP IGNPGVLDRS VSGRETSFGV GKPIQLVKRE SEWRKDSGSN LEVTGERKSE  240
VDVADDLFNA YMNLENLETL NSSGTEDRDM DSKASGTKTY GGESSDNEVD SRVHKHPISI  300
QGMSSGVSNE KREGVKRRAA GDIAPTVRHY RSVSMDSYMG SLQFDEDTPK IPPSGNHGNH  360
HSPGSPGDAN SSKFNFELGS SEFNESELKK IMENEKLAEM ASVDPKRVKR ILANRQSAAR  420
SKQRKMQYIA ELEQKVQTLQ TEATTLSAQL TMLQRDSAEL TSQNNELKFR LQAMEQQAQL  480
KDALNEALAA EVQRLKLTAA EFSGEVHLSN CMAQQLSIDH QMLQLQPQQQ QQRNIYQMQQ  540
QHQQPQQGHH NQSQTQQQNG DASAANESK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1418426ARSKQRKMQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478118.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478119.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478120.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478121.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478123.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478124.10.0PREDICTED: uncharacterized protein LOC105793819
TrEMBLA0A0D2SEH90.0A0A0D2SEH9_G
STRINGVIT_03s0038g00860.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-117bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]