PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G088800.1
Common NameB456_005G088800, LOC105797160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 299aa    MW: 33899.4 Da    PI: 7.0063
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G088800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.74e-52101341128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lp+GfrFhPtdeelv++yL++k++++++ +  +i+e+d+yk++PwdLp  +  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+
  Gorai.005G088800.1  10 LPAGFRFHPTDEELVMHYLCRKCASQSIAV-PIIAELDLYKYDPWDLPDLALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKP 99 
                         799************************999.88***************65556799*********************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + +   + vg+kk Lvfy+g+apkgekt+W+mheyrl
  Gorai.005G088800.1 100 IGQ--PKPVGIKKALVFYSGKAPKGEKTNWIMHEYRL 134
                         *98..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-627160IPR003441NAC domain
PROSITE profilePS5100559.90910160IPR003441NAC domain
PfamPF023652.1E-2711134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MTATELQLRL PAGFRFHPTD EELVMHYLCR KCASQSIAVP IIAELDLYKY DPWDLPDLAL  60
YGEKEWYFFS PRDRKYPNGS RPNRAAGSGY WKATGADKPI GQPKPVGIKK ALVFYSGKAP  120
KGEKTNWIMH EYRLADVDRS VRKKNSLRLD DWVLCRIYNK KGCIEKQPPR GSVTKKASVT  180
EIEESKPDNG TLGVEACEFP PAVTAVGNDY VYFDSSESVP RVHTDSSCSE HAVSREFMTE  240
VQSVPKWKEE LGMANNNALD FAYNYLDTNM DIGFASQMQT SNQLSPYQDI FMYLQKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-8041669174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.35561e-156flower| flowering
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO488301731e-156
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7063410.0EU706341.1 Gossypium hirsutum NAC domain protein NAC3 (NAC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482550.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390131e-144NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A0D2N9J60.0A0A0D2N9J6_GOSRA; Uncharacterized protein
STRINGGorai.005G088800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-146NAC family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  3. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  4. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  5. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  6. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  7. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  8. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  9. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  10. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]