PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G079700.1
Common NameB456_005G079700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 229aa    MW: 24993.1 Da    PI: 7.6421
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G079700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.51.6e-09172219552
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                         kr++r   NR +A rs +RK  ++ eLe+kv++L++e + L  ++ +l
  Gorai.005G079700.1 172 KRAKRILANRQSAARSKERKIRYTNELEKKVQTLQTEATNLSAQVTML 219
                         9**************************************999888777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-6168225IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.048170220IPR004827Basic-leucine zipper domain
PfamPF001702.4E-8172219IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.25E-10172220No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-10172220No hitNo description
CDDcd147032.29E-23173220No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MEQKLRMEID QMPPRGAHHR RAHSDTTFRF DDLLLFDPSD LDLSCLDLPD SSSNPSLPPV  60
APVPAESSDD SSCNGPPRST LNNPRHIRSL SVDSDFFDGL GLTGPAISGG AGDEKFGGKR  120
GAGEKRVHHR HSNSMDGSTT ASFDVESLMA VDGVKKTMAP DRLAELALID PKRAKRILAN  180
RQSAARSKER KIRYTNELEK KVQTLQTEAT NLSAQVTMLQ VKSTLCWV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007019465.11e-117VIRE2-interacting protein 1, putative
SwissprotQ9MA753e-63VIP1_ARATH; Transcription factor VIP1
TrEMBLA0A0D2SCW41e-169A0A0D2SCW4_G
STRINGPOPTR_0005s21300.12e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79932639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.12e-50VIRE2-interacting protein 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]