PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G076200.5
Common NameB456_005G076200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 573aa    MW: 64249 Da    PI: 4.8169
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G076200.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.16.9e-53211472128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         ppGfrFhPtdeelv +yLk+k+ +k+l+l ++i+e+d+yk +P++Lp +  +k+++++w+fF++rd+ky++g r+nrat +gyWkatgkd+
  Gorai.005G076200.5  21 PPGFRFHPTDEELVLYYLKRKICKKRLKL-DIIRETDVYKRDPEELPgQsVLKNGDRQWFFFCPRDRKYPNGARSNRATIHGYWKATGKDR 110
                         8****************************.99**************96447788999********************************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++ ++++vg+kktLvfy+grap+ge+tdWvmhey+l
  Gorai.005G076200.5 111 SITC-NSRVVGIKKTLVFYRGRAPNGERTDWVMHEYTL 147
                         ****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.16E-5917170IPR003441NAC domain
PROSITE profilePS5100555.46220170IPR003441NAC domain
PfamPF023651.1E-2721147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MKVTATAVTV DSGFGDDQVW PPGFRFHPTD EELVLYYLKR KICKKRLKLD IIRETDVYKR  60
DPEELPGQSV LKNGDRQWFF FCPRDRKYPN GARSNRATIH GYWKATGKDR SITCNSRVVG  120
IKKTLVFYRG RAPNGERTDW VMHEYTLDEE ELKRCQNVKD YYALYKLYKK SGPGPKNGEQ  180
YGAPFKEEAW DDEEYSSIPL DTITPVKPPN EVIPDDNVKA NVQSESPLSD IEEFMRQFAD  240
EPALPQPQAY HSHVLPQVVS AEDTQSTLLD PSPRGVLFPE QLTVLHGQAS FEFPESPISQ  300
LLLQEAPEVT PVTDHLDQVP QLCEEDFLEI DDLLGPEPLI SNIEKPVENK QFNELDGLSE  360
FDLYHDAAMF LQDMGSIDQG TVPFLYDNMI NQWQNQANAN MMEQHLQPQL NASGGNMLNQ  420
MNQQLQMDQI NGALWTHDQN GDVFIPSGSN LGNASPTSGF VNNGPKQDQG NKNDGSGGGS  480
WFSSSLWSFV DSIPTAPASA AESPLVNRAL ERMSSFSKLR IHAMNTAVNG SASARRRSRN  540
RGFFFISILG ALCAVLWFLI GTVRVLGRSI SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-482114716140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13847KRKICKKRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472220.0KC847222.1 Gossypium hirsutum NAC domain protein NAC45 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482360.10.0PREDICTED: NAC domain-containing protein 17-like isoform X3
TrEMBLA0A0D2SCE80.0A0A0D2SCE8_GOSRA; Uncharacterized protein
STRINGGorai.005G076200.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-111NAC domain containing protein 17
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]