PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G015900.1
Common NameB456_005G015900, LOC105796381
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 387aa    MW: 42018.8 Da    PI: 6.2933
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G015900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1315.6e-10207265563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l+ l+    +l++e+
  Gorai.005G015900.1 207 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLNAQLSLLQRDTGTLTAEN 265
                         9***********************************************99888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.0E-16203267IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.001205268IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-10207261No hitNo description
PfamPF001709.6E-9207264IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.27E-10207261No hitNo description
CDDcd147031.04E-24208257No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MEKDKSPGLP PPSGRYTGFA AVGNVLNSTG CFGQSSDANR FSQDISKMPD NPPKNLGHRR  60
AHSEILTLPD DISFDSDLGV VGAADGPSYS DDTEEDMFSM FIDMDKFNSS SATSTFQVGE  120
SSAPAAAPAT AHMAAAAWTG MNGENQSVTV GSSEKPRVRH QHSQSMDGST SIKPEMLMSG  180
SEEVSPAEAK KALSATKLAE LAIIDPKRAK RIWANRQSAA RSKERKMRYI AELERKVQTL  240
QTEATSLNAQ LSLLQRDTGT LTAENNELKL RLTTMEQQVH LQDALNEALK DEIQHLKVLT  300
GQSIPNGGPM MNYASYGTNQ QYYPNNQAMH TLLTAQQFQQ LQIQSQKQPH PFQLQHQTGD  360
MGVRGPVPTP NHKDASSDVS LTASKD*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5897643e-68JX589764.1 Gossypium hirsutum clone NBRI_GE24526 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012481534.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-155POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0D2RE180.0A0A0D2RE18_G
STRINGVIT_05s0102g01120.t011e-172(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-158bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]