PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G292000.1
Common NameB456_004G292000, LOC105793761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 255aa    MW: 28704 Da    PI: 9.774
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G292000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.51.5e-171150342
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        i n+s r+ tf kR++g++KK +ELS+LC+++++ i++s+
  Gorai.004G292000.1 11 ITNDSARKATFKKRKKGLMKKVSELSTLCGIDACAIMYSP 50
                        89*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-25160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.806149IPR002100Transcription factor, MADS-box
CDDcd002669.79E-24285No hitNo description
SuperFamilySSF554558.24E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MTRKKVKLAY ITNDSARKAT FKKRKKGLMK KVSELSTLCG IDACAIMYSP YESQPEVWPS  60
AMGVQRVLSK FKKVPEMEQS KKMVNQESFL AQRIAKANEQ LKKQCKDNRE KEMTHVMFQN  120
LNGKAGILGL NVVDLNDLAW LIDQNLKEID KRVDALAKTS LNPQGQGGSS SSVTVPPMVT  180
PEVASTGDMV QGEVNNMDWM QRQQWIMELM NTNNNPQTQT HVGFSGEETV FPFGDKIHNV  240
NNGLWSNAFF PWEK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYITNDSARKATFKKRK
22125KKRKK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6159861e-114JX615986.1 Gossypium hirsutum clone NBRI_GE60302 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478057.10.0PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK38e-67AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A0D2R6070.0A0A0D2R607_GOSRA; Uncharacterized protein
TrEMBLA0A2P5QUC90.0A0A2P5QUC9_GOSBA; Uncharacterized protein
STRINGGorai.004G292000.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-67AGAMOUS-like 80
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]