PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G270400.2
Common NameB456_004G270400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 262aa    MW: 30294.7 Da    PI: 5.6361
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G270400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM102.17.7e-3218102388
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         pGfrFhPtdeel+ +yL++kv++k+l++ e ik++diyk++P+dLpk+   +e+e+yfF++r +ky+++ r+nr+t sg+Wkatgk
  Gorai.004G270400.2  18 PGFRFHPTDEELIGFYLRRKVDNKSLRI-ELIKQIDIYKYDPSDLPKTSMMGENELYFFCRRGRKYRNSVRPNRVTGSGFWKATGK 102
                         9***************************.89***************87777899*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.19E-439136IPR003441NAC domain
PROSITE profilePS5100528.92316171IPR003441NAC domain
PfamPF023652.2E-1618115IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MNMVHGTTTT VDEDVPLPGF RFHPTDEELI GFYLRRKVDN KSLRIELIKQ IDIYKYDPSD  60
LPKTSMMGEN ELYFFCRRGR KYRNSVRPNR VTGSGFWKAT GKGTKTDWMM HEFRLPNPTL  120
TAQDAEVWTI CRIFKRHKKN KQEWRQGAAK RASTSNGNGV HGYERCSVES SSHENYITFG  180
SQSIENYDDN DDDDGVDGEM VMDHMKNDGS CRREWYHEEM QCMVSSSSPS SSFSTENDFF  240
TNANWDELKS VVELDLDPFL L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-3761371166NO APICAL MERISTEM PROTEIN
1ut4_B8e-3761371166NO APICAL MERISTEM PROTEIN
1ut7_A8e-3761371166NO APICAL MERISTEM PROTEIN
1ut7_B8e-3761371166NO APICAL MERISTEM PROTEIN
4dul_A8e-3761371166NAC domain-containing protein 19
4dul_B8e-3761371166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472400.0KC847240.1 Gossypium hirsutum NAC domain protein NAC63 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314214.11e-175transcription factor JUNGBRUNNEN 1-like
RefseqXP_012477038.11e-175PREDICTED: transcription factor JUNGBRUNNEN 1-like
RefseqXP_012477039.11e-175PREDICTED: transcription factor JUNGBRUNNEN 1-like
RefseqXP_012477040.11e-175PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLA0A0D2PJ580.0A0A0D2PJ58_GOSRA; Uncharacterized protein
STRINGGorai.004G270400.11e-175(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-66NAC domain containing protein 42
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]