PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G270200.1
Common NameB456_004G270200, LOC105792793
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 301aa    MW: 34065.2 Da    PI: 5.9319
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G270200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.32.3e-47331583128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                         pGfrFhPt+eelv +yL++kv+++ l++ e ike+diyk++P+dLpk+   +e+++yfF+kr +ky+++ r+nr+t sg+Wkatg dk+v+
  Gorai.004G270200.1  33 PGFRFHPTEEELVGFYLRQKVDNNCLTI-ELIKEIDIYKYDPSDLPKTGMMGENDLYFFCKRGRKYRNSVRPNRVTGSGFWKATGIDKPVF 122
                         9************************999.89***************76667899************************************9 PP

                 NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         s  +ge++glkktLv+y+g+a kg+ktdW+mhe+rl
  Gorai.004G270200.1 123 SVkSGEAIGLKKTLVYYHGSAGKGTKTDWMMHEFRL 158
                         9868899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5328179IPR003441NAC domain
PROSITE profilePS5100550.63631179IPR003441NAC domain
PfamPF023652.5E-2433158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MFVPFTSLSQ QKESKMNMVH GTTSTVDEGV PLPGFRFHPT EEELVGFYLR QKVDNNCLTI  60
ELIKEIDIYK YDPSDLPKTG MMGENDLYFF CKRGRKYRNS VRPNRVTGSG FWKATGIDKP  120
VFSVKSGEAI GLKKTLVYYH GSAGKGTKTD WMMHEFRLPN PTLTAQEAEV WTICRIFKRN  180
KKIKQDSRQG AAKRASTSNG NGVDGYKRCS VESNSHENYI TIGSQIIENY DDDDDDGEMV  240
MDHGMNDESC RGEWYHGELQ RMASSSSPSS SFSTVNDFFT NANWDELKSI LDLDLDPFLL  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-473318019166NO APICAL MERISTEM PROTEIN
1ut4_B4e-473318019166NO APICAL MERISTEM PROTEIN
1ut7_A4e-473318019166NO APICAL MERISTEM PROTEIN
1ut7_B4e-473318019166NO APICAL MERISTEM PROTEIN
3swm_A4e-473318022169NAC domain-containing protein 19
3swm_B4e-473318022169NAC domain-containing protein 19
3swm_C4e-473318022169NAC domain-containing protein 19
3swm_D4e-473318022169NAC domain-containing protein 19
3swp_A4e-473318022169NAC domain-containing protein 19
3swp_B4e-473318022169NAC domain-containing protein 19
3swp_C4e-473318022169NAC domain-containing protein 19
3swp_D4e-473318022169NAC domain-containing protein 19
4dul_A4e-473318019166NAC domain-containing protein 19
4dul_B4e-473318019166NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, root caps, cotyledons, tips and margin of young leaves, senescent regions of fully expanded leaves and floral tissues, including old sepals, petals, staments, mature anthers and pollen grains. Not detected in the abscission zone of open flowers, emerging lateral roots and root meristematic zones. {ECO:0000269|PubMed:22345491}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472400.0KC847240.1 Gossypium hirsutum NAC domain protein NAC63 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477037.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like isoform X2
SwissprotQ9SK559e-79NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A0D2RBG70.0A0A0D2RBG7_GOSRA; Uncharacterized protein
STRINGGorai.004G270200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2481034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-81NAC domain containing protein 42
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  3. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  4. Shahnejat-Bushehri S, et al.
    Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato.
    Front Plant Sci, 2017. 8: p. 214
    [PMID:28326087]
  5. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  6. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]