PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G268400.1
Common NameB456_004G268400, LOC105792773
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 323aa    MW: 37027.4 Da    PI: 4.6808
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G268400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.31e-5561331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeelv +yL++k++g+++el evi+evd+yk+ePwdLp k  + +++ ewyf+s+rdkky++g+r+nrat+ gyWkatgkd
  Gorai.004G268400.1   6 LPPGFRFHPTDEELVAYYLHNKITGRPIEL-EVIPEVDLYKFEPWDLPdKsYLPSKDMEWYFYSPRDKKYPNGSRTNRATRGGYWKATGKD 95 
                         79****************************.99**************95335666888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v s ++++vg+kktLv+y+grap+g +t+Wvmheyrl
  Gorai.004G268400.1  96 RAVQS-QKRAVGIKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                         ****9.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-643150IPR003441NAC domain
PROSITE profilePS5100560.7016150IPR003441NAC domain
PfamPF023651.3E-287133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLHNKITG RPIELEVIPE VDLYKFEPWD LPDKSYLPSK  60
DMEWYFYSPR DKKYPNGSRT NRATRGGYWK ATGKDRAVQS QKRAVGIKKT LVYYRGRAPH  120
GIRTNWVMHE YRLLNSTLKD CYALCRVFKK NIQILPKEEE AVGNNNNVDK EKQLHGEETS  180
GNEIPKGRQV EIEDENLITS SSDLTQGTSY ETGMAMADDN QPPFTSDEAN SSANTISSSL  240
AMDFSSNLIQ AEGYTNVEYQ VPYPPLELED FPQINLSETK AEMMDEYMVY DKYKDYMNGS  300
LEEIFSLCSS QDISMPLYMH QD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-58115112166NO APICAL MERISTEM PROTEIN
1ut4_B4e-58115112166NO APICAL MERISTEM PROTEIN
1ut7_A4e-58115112166NO APICAL MERISTEM PROTEIN
1ut7_B4e-58115112166NO APICAL MERISTEM PROTEIN
3swm_A5e-58115115169NAC domain-containing protein 19
3swm_B5e-58115115169NAC domain-containing protein 19
3swm_C5e-58115115169NAC domain-containing protein 19
3swm_D5e-58115115169NAC domain-containing protein 19
3swp_A5e-58115115169NAC domain-containing protein 19
3swp_B5e-58115115169NAC domain-containing protein 19
3swp_C5e-58115115169NAC domain-containing protein 19
3swp_D5e-58115115169NAC domain-containing protein 19
4dul_A4e-58115112166NAC domain-containing protein 19
4dul_B4e-58115112166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477006.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLA0A0D2R4U90.0A0A0D2R4U9_GOSRA; Uncharacterized protein
STRINGGorai.004G268400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81232640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-108NAC domain containing protein 20
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]