PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G267300.1
Common NameB456_004G267300, LOC105793741
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 390aa    MW: 43877.8 Da    PI: 7.5165
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G267300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.52.5e-5381371129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeel+++yL+kkv+ +k+++ evi+evd++k+ePw+L++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+
  Gorai.004G267300.1   8 VPPGFRFHPTDEELLHYYLTKKVSFQKFDM-EVIREVDLNKMEPWELQErcRIGSsPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGR 97 
                         69****************************.99**************963433332456******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk + + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  Gorai.004G267300.1  98 DKCIRN-SYKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 137
                         *****9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-607159IPR003441NAC domain
PROSITE profilePS5100557.828159IPR003441NAC domain
PfamPF023651.5E-279136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MGSTNGGVPP GFRFHPTDEE LLHYYLTKKV SFQKFDMEVI REVDLNKMEP WELQERCRIG  60
SSPQNEWYFF SHKDRKYPTG SRTNRATNAG FWKATGRDKC IRNSYKKIGM RKTLVFYRGR  120
APHGQKTDWI MHEYRLEDGD DPQGNPTEDG WVVCRVFKKK NLFKVSNTIN GGSSLNSSDQ  180
HHHLNMNHTN TTSSSSQTQP PPPLSFMHRS NDQYNLNTTT TTTLELNKAE LALHYPPHIP  240
TPTHQYSLFH PQTLLPTHKS MTAYEYAPPL PVGLPSESSH PIMIKQLMSS NPRDCDSGSE  300
SVRYQCETGL EGVAAGGGGG SGRDDENEGM NEWGMLDRLV TSHMGIGQDS SSKGVRFEDS  360
NNNGTNATSV HPINQLSLRG EMDFWGYGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-52416113167NO APICAL MERISTEM PROTEIN
1ut4_B1e-52416113167NO APICAL MERISTEM PROTEIN
1ut7_A1e-52416113167NO APICAL MERISTEM PROTEIN
1ut7_B1e-52416113167NO APICAL MERISTEM PROTEIN
4dul_A1e-52416113167NAC domain-containing protein 19
4dul_B1e-52416113167NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detectable in lateral root development when they reach 10 mm long. {ECO:0000269|PubMed:20197506}.
UniprotTISSUE SPECIFICITY: Expressed throughout the root cap, in both columella (COL) and lateral root cap (LRC) cells, with higher levels in the COL-adjoining LRC than the upper LRC. Also present at low levels expression in the tips of cotyledons and the cotyledon vasculature, as weel as in vasculature of the first pair of true leaves and at the hydathodes. {ECO:0000269|PubMed:20197506}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6161430.0JX616143.1 Gossypium hirsutum clone NBRI_GE60576 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478041.10.0PREDICTED: protein BEARSKIN2
SwissprotQ9SV871e-148BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A0D2R4S80.0A0A0D2R4S8_GOSRA; Uncharacterized protein
STRINGGorai.004G267300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52132648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-133NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]