PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G258200.1
Common NameB456_004G258200, LOC105793734
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 184aa    MW: 21777.2 Da    PI: 9.0644
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G258200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM99.54.8e-31201471128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         lp G+rF P+d+el+++yL +k++g +l+  +v+k++d y+++P ++     k+  +++e y+F+k+++  ++ +r +r t++gyWk+ gk
  Gorai.004G258200.1  20 LPIGYRFVPRDHELISFYLFNKIKGFQLPS-DVVKNIDFYYLDPFHFSpCefKHGRKNNEAYYFTKTKEIRSKMDRIERHTRNGYWKSCGK 109
                         699**************************9.99**************64423444566799****************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +e+++ +++ +glk+ +vf+  r p+    +Wvmhe++l
  Gorai.004G258200.1 110 AEEIKH-GDRIIGLKRLFVFH-WRIPELGFGNWVMHEFSL 147
                         ******.999***********.7888989*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-3318175IPR003441NAC domain
PROSITE profilePS5100532.84820177IPR003441NAC domain
PfamPF023652.2E-1821147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MAAALVSDDS FLDEYEDKAL PIGYRFVPRD HELISFYLFN KIKGFQLPSD VVKNIDFYYL  60
DPFHFSPCEF KHGRKNNEAY YFTKTKEIRS KMDRIERHTR NGYWKSCGKA EEIKHGDRII  120
GLKRLFVFHW RIPELGFGNW VMHEFSLHPT LLIPHPLLDE KIKAKIQRCV ICRIVNREGY  180
YGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-182018115172Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478033.11e-135PREDICTED: NAC domain-containing protein 45-like
RefseqXP_016690930.11e-135PREDICTED: NAC domain-containing protein 45-like
TrEMBLA0A0D2N3U61e-134A0A0D2N3U6_GOSRA; Uncharacterized protein
TrEMBLA0A1U8JKW21e-134A0A1U8JKW2_GOSHI; NAC domain-containing protein 45-like
STRINGGorai.004G258200.11e-134(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17601710
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.12e-22NAC domain containing protein 57
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]