PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G246700.2
Common NameB456_004G246700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 318aa    MW: 35094.8 Da    PI: 5.9073
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G246700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.32.5e-16208263358
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                         + kr rr+ +NRe+ArrsR+RK+a + eLe+ v +L  eN +L k+l  +++++ +
  Gorai.004G246700.2 208 DAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENATLLKRLTDISQKYNE 263
                         68******************************************999999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000419.6E-583105IPR001630cAMP response element binding (CREB) protein
Gene3DG3DSA:1.20.5.1703.2E-12204261No hitNo description
PRINTSPR000419.6E-5205221IPR001630cAMP response element binding (CREB) protein
SMARTSM003389.0E-19206270IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.588208263IPR004827Basic-leucine zipper domain
PfamPF001706.0E-14209262IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-12210260No hitNo description
PROSITE patternPS000360213228IPR004827Basic-leucine zipper domain
PRINTSPR000419.6E-5223243IPR001630cAMP response element binding (CREB) protein
PRINTSPR000419.6E-5243260IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MDRVFSVEEI SDHFWPSSSS SATTNSASAD DDNKSGSKMN RSASEWAFQQ FIREEVDKEG  60
EDEGVTEGDL KKKNGTASFN NGCLESNGNN NVLVDSDEYQ AFLKNKLNLA CAAVAMSRAS  120
FVKPQDSAVR ADSGSQASDT PQSVSIATSK GAGDKNGNAL SGFPSVVNGQ KKIGAQVRPS  180
TSGSSREMSE DDEVEGENET MENMDPADAK RVRRMLSNRE SARRSRRRKQ AHLTELETQV  240
SQLRVENATL LKRLTDISQK YNESAVDNRV LKADVETLRA KVNESFDLLV LKLSFLLHRE  300
PIWISQRSNR LKFWLKS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222229RRSRRRKQ
2224229SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.11650.0flower|seedling| flowering
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5275555e-91HQ527555.1 Gossypium herbaceum clone NBRI_C_EYT27PB01AX7O7 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012476676.10.0PREDICTED: light-inducible protein CPRF2-like
SwissprotQ990901e-78CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLA0A0D2S5L80.0A0A0D2S5L8_G
STRINGVIT_14s0030g02200.t017e-96(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.31e-55bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]