PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G221300.1
Common NameB456_004G221300, LOC105792311
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 269aa    MW: 30999.7 Da    PI: 6.178
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G221300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.85.4e-50101381129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF P+deelv++yL kkv+++++    ++ ++d++++ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd++
  Gorai.004G221300.1  10 LPPGFRFYPSDEELVCHYLFKKVANEEILK-GTLVDIDLHTCEPWQLPEVAKLNASEWYFFSFRDRKYATGFRTNRATASGYWKATGKDRT 99 
                         79*************************877.78***************87788899*********************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                         v++  ++e+vg++ktLvf+k+rap+g kt W+mhe+rle
  Gorai.004G221300.1 100 VIDPrTQEVVGMRKTLVFHKNRAPNGIKTGWIMHEFRLE 138
                         **9867778***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-608157IPR003441NAC domain
PROSITE profilePS5100557.3710156IPR003441NAC domain
PfamPF023652.7E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLFK KVANEEILKG TLVDIDLHTC EPWQLPEVAK  60
LNASEWYFFS FRDRKYATGF RTNRATASGY WKATGKDRTV IDPRTQEVVG MRKTLVFHKN  120
RAPNGIKTGW IMHEFRLETP HMPPKEDWVL CRVFHKNKGD NINNNPTTML ETSSSRAFSL  180
RDQTSLHYGH QLQQIATSLS FPQPHPSHGQ SLLSLLQQNN NNNPYTNEVI SSKVEDEFDF  240
FWDINTVENN LEDIKFDNNE DDDNVGFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-47915716166NO APICAL MERISTEM PROTEIN
1ut4_B5e-47915716166NO APICAL MERISTEM PROTEIN
1ut7_A5e-47915716166NO APICAL MERISTEM PROTEIN
1ut7_B5e-47915716166NO APICAL MERISTEM PROTEIN
3swm_A6e-47915719169NAC domain-containing protein 19
3swm_B6e-47915719169NAC domain-containing protein 19
3swm_C6e-47915719169NAC domain-containing protein 19
3swm_D6e-47915719169NAC domain-containing protein 19
3swp_A6e-47915719169NAC domain-containing protein 19
3swp_B6e-47915719169NAC domain-containing protein 19
3swp_C6e-47915719169NAC domain-containing protein 19
3swp_D6e-47915719169NAC domain-containing protein 19
4dul_A5e-47915716166NAC domain-containing protein 19
4dul_B5e-47915716166NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472130.0KC847213.1 Gossypium hirsutum NAC domain protein NAC36 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012476276.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE62e-64NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0D2R2730.0A0A0D2R273_GOSRA; Uncharacterized protein
STRINGGorai.004G221300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34362862
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.15e-94NAC domain containing protein 74
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  6. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  7. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]