PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G218300.1
Common NameB456_004G218300, LOC105792280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 451aa    MW: 48130.6 Da    PI: 7.2596
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G218300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.77.1e-15238293358
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                         + kr+rr+ +NRe+ArrsR+RK+a++ eLe+ v +L ae ++L k+l  ++ ++++
  Gorai.004G218300.1 238 DAKRARRMRSNRESARRSRRRKQAQMNELETQVGQLRAEHSSLLKRLTDMNHKYDE 293
                         68****************************************99888777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.1E-11235290No hitNo description
SMARTSM003387.3E-18236300IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.323238293IPR004827Basic-leucine zipper domain
PfamPF001701.7E-12239292IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.07E-10240290No hitNo description
PROSITE patternPS000360243258IPR004827Basic-leucine zipper domain
PfamPF124983.6E-19307415IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MVEREEKQDQ TQIANRRGKK ISLKTMNSVF SVDDFSDPFW VASATGAAAG MSRSQSEWAL  60
EKFLEEFSGA GAAIQGSRAG ENVIGTSLAA PQAPVSKSEN GDGDGGAVEV KKPNNLNPPP  120
SDSTPTVPID ADEYRAILKN KLHQACAAVA LSRASAVKAE GSSAQAENQA LQSGSDVQGS  180
SKTQEQGEPD AGISAVSTTQ KKSGTQMRQA TSGSSREDSD DGELEGDTET TENMDPADAK  240
RARRMRSNRE SARRSRRRKQ AQMNELETQV GQLRAEHSSL LKRLTDMNHK YDEAAVDNRI  300
LKADIETLRA KVKMAEETVK RVTGINPVLL SRPSVPSVPV PFVSSPLESS TGSVPLPPNT  360
SKLFHQPVPN IAAPIHHPRL DNSFTGNNLV TPIVNPQTEI GVENVNKTSA LQHAPRGVQK  420
QIGPCVSPCV PMPGWEPGLP HGAATNNKQS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1252259RRSRRRKQ
2254259SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012476236.10.0PREDICTED: basic leucine zipper 10-like
SwissprotO227633e-76BZP10_ARATH; Basic leucine zipper 10
TrEMBLA0A0D2R2090.0A0A0D2R209_G
STRINGPOPTR_0005s23900.17e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.25e-54bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]