PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G193200.1
Common NameB456_004G193200, LOC105792012
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 539aa    MW: 59815.9 Da    PI: 6.606
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G193200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.94.3e-16741135
                GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                        C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Gorai.004G193200.1  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                        ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.0E-10153IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.85E-11546No hitNo description
CDDcd002023.02E-16655No hitNo description
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003207.0E-14741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.4E-12741IPR013088Zinc finger, NHR/GATA-type
PfamPF139197.7E-13279366IPR028020ASX homology domain
PfamPF165504.3E-9298365IPR032368UCH-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLTNYTPLHA RVEPEDYEDH  60
RASRLKIISI NKNKEVKLLK RKSNHDKAVV VPDYNQGNRK FVDDDTSNRS SSGSAISNSE  120
SCAQFGCADA GDLTGPAQSN VWDSMVPSKK RTCVNRPKPS SVEKLTKDLY TILHEQQSSY  180
FSGSSEEDLL LESETPMVSV EIGHGSVLIR HPSSIAREEE SEASSLSVEN RQYSRNEAYS  240
YSSSFPACND SKGIKFLGHG IERAKSSAGQ GIQHEQLNRD KSQHEKSLLM ESHNSPLCNI  300
DLNDILNYEE FVKCLTNEEQ QQLLQYLPPL DIANLPDSLE SMFESPQFKE NLCYFQQLLE  360
EGVFSVSVPG VKVEDCKTLK RLALFDLTKS HWVERRQTLK KCNSIPGSMN ARGPNAIASN  420
NSVTMKRSRN SQIQNFPESR TLKSPKRVIM KASCENKELI DNDGFCFSPR SLFALPSDGS  480
SLMLDSLHFV DESSDQDLLL DVPSNGSFAQ AELLHPALSF GQQASTSSSS AHPNPFHP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475821.10.0PREDICTED: GATA transcription factor 26-like
SwissprotQ8W4H11e-156GAT26_ARATH; GATA transcription factor 26
TrEMBLA0A0D2S2J30.0A0A0D2S2J3_G
STRINGPOPTR_0003s08080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16062785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-140GATA transcription factor 26
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]