PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G164700.1
Common NameB456_004G164700, LOC105791673
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 256aa    MW: 28237.2 Da    PI: 7.4723
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G164700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83.1e-18168202135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         Cs+C + kTp+WR gp g+ktLCnaCG++y++ +l
  Gorai.004G164700.1 168 CSHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 202
                         *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.6E-823255IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.385162198IPR000679Zinc finger, GATA-type
SMARTSM004011.7E-15162212IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.62E-14166225No hitNo description
Gene3DG3DSA:3.30.50.108.3E-14166200IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.64E-13167214No hitNo description
PROSITE patternPS003440168193IPR000679Zinc finger, GATA-type
PfamPF003204.1E-16168202IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MDIYGISTSE QLDVDDLLDL SNDEFFPSAS AATSHDQFPP SETHFSDASA ASSSSAALTP  60
SFSLDFNHDI CLPSDDVAEL EWLSQFVEDS FTDFPSYSLP GILNPRNDNS SFSSKARSKR  120
SRAVTTLNGT NWTTTTSGAA GTLTGKTKTK REIQRQASPA AVEGMRRCSH CASEKTPQWR  180
TGPLGPKTLC NACGVRYKSG RLVPEYRPAA SPTFVLTQHS NSHRKVLELR RQKEEQSTRR  240
QQEQVCRQQH RQQVC*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475317.10.0PREDICTED: GATA transcription factor 4
SwissprotO497434e-76GATA4_ARATH; GATA transcription factor 4
TrEMBLA0A0D2S0Q50.0A0A0D2S0Q5_G
STRINGVIT_15s0021g02510.t012e-81(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32032666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.13e-63GATA transcription factor 4
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]