PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G129200.2
Common NameB456_004G129200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 363aa    MW: 40738.4 Da    PI: 6.7837
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G129200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM99.45.1e-312710054128
                 NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  Gorai.004G129200.2  27 PQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYS-SFRRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 100
                         4679*************************************.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100538.0331131IPR003441NAC domain
SuperFamilySSF1019414.45E-3527131IPR003441NAC domain
PfamPF023653.3E-1527100IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MLFGKLILTS LSPGIYKVQK CRIGSTPQND WYFFSHKDKK YPTGTRTNRA TAAGFWKATG  60
RDKIIYSSFR RIGLRKTLVF YKGRAPHGQK SDWIMHEYRL DDTNTLDSNA SNPIGDSMAE  120
EGWVVCRVFR KKNYQKTLES PKSSSSTSLD SKTQMLCSSN DGVLDQFFLY MGRTCKMEND  180
SLNIPNANTN NHLRMLVANN AGGISDGLHE SFMHLPRLES QSLPALPINT PHFDQHRSFK  240
PCFQSIDDML TEIEPSAAAG FDNTNNESKN GVNDWVTLDR LVASQLNGQV ETSKQLSCFT  300
DPNAVFGLCH DDDEDDDDIQ LSHINMHRSN QNPQVYSNEN DLWSLTKSSS PSSSDPLCHL  360
SV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-302813370167NO APICAL MERISTEM PROTEIN
1ut4_B1e-302813370167NO APICAL MERISTEM PROTEIN
1ut7_A1e-302813370167NO APICAL MERISTEM PROTEIN
1ut7_B1e-302813370167NO APICAL MERISTEM PROTEIN
3swm_A2e-302813373170NAC domain-containing protein 19
3swm_B2e-302813373170NAC domain-containing protein 19
3swm_C2e-302813373170NAC domain-containing protein 19
3swm_D2e-302813373170NAC domain-containing protein 19
3swp_A2e-302813373170NAC domain-containing protein 19
3swp_B2e-302813373170NAC domain-containing protein 19
3swp_C2e-302813373170NAC domain-containing protein 19
3swp_D2e-302813373170NAC domain-containing protein 19
4dul_A1e-302813370167NAC domain-containing protein 19
4dul_B1e-302813370167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474773.10.0PREDICTED: NAC domain-containing protein 43-like
TrEMBLA0A0D2PB690.0A0A0D2PB69_GOSRA; Uncharacterized protein
STRINGGorai.004G129200.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.16e-61NAC family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]