PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G125900.2
Common NameB456_004G125900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 456aa    MW: 50682.1 Da    PI: 5.5506
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G125900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.43.2e-5491371128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lp GfrF+Ptdeel+++yL++k++gk++++ evi+e+d++k+ePwdLp+  ++++++ ew+fF++ d+ky++g+r nrat++gyWkatgkd
  Gorai.004G125900.2   9 LPIGFRFRPTDEELIHFYLRAKINGKRNDEVEVIREIDVCKCEPWDLPHmsAIQTRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKD 99 
                         699************************9999*****************4347777888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++s +++l+g+kk+Lvfy+grap+g++t+Wvmheyr 
  Gorai.004G125900.2 100 RKIKS-GSSLIGMKKSLVFYTGRAPRGKRTNWVMHEYRT 137
                         *****.99*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-594160IPR003441NAC domain
PROSITE profilePS5100557.1549160IPR003441NAC domain
PfamPF023653.5E-2710136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MAVLSLNSLP IGFRFRPTDE ELIHFYLRAK INGKRNDEVE VIREIDVCKC EPWDLPHMSA  60
IQTRDPEWFF FCPLDRKYPN GNRLNRATEA GYWKATGKDR KIKSGSSLIG MKKSLVFYTG  120
RAPRGKRTNW VMHEYRTTLI ELDGTKPGQN PFVICRLFKK QDESIEDTNG DEVDVSSPTE  180
DMQSELEGPE DSPALEGVAQ PKFPHNNGTC SGGLPNEVVS NAVPPMLECN IVDSKAYSVT  240
GQVAEIVTDK VDQVGEALNH FYDPMVEPPD CKFFSPLRSQ VEAEQAPWMF HQVGSSLSAV  300
DVDSSSQQYS ANESETPKTM AVVEDGRIRS EQDAEVAQVL MIGSQLGREI ADKGTPLEIK  360
ATAQDCTIPI NKDIVLNSKE EPSNHVTTTC NLDNAITGIR IRPHAAQSQT NIKNSVTQGY  420
APRRIRLQCK LQVGTYYSEG KKDGSKPVVT KVRNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-43416412169NO APICAL MERISTEM PROTEIN
1ut4_B1e-43416412169NO APICAL MERISTEM PROTEIN
1ut7_A1e-43416412169NO APICAL MERISTEM PROTEIN
1ut7_B1e-43416412169NO APICAL MERISTEM PROTEIN
3swm_A1e-43416415172NAC domain-containing protein 19
3swm_B1e-43416415172NAC domain-containing protein 19
3swm_C1e-43416415172NAC domain-containing protein 19
3swm_D1e-43416415172NAC domain-containing protein 19
3swp_A1e-43416415172NAC domain-containing protein 19
3swp_B1e-43416415172NAC domain-containing protein 19
3swp_C1e-43416415172NAC domain-containing protein 19
3swp_D1e-43416415172NAC domain-containing protein 19
4dul_A1e-43416412169NAC domain-containing protein 19
4dul_B1e-43416412169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474699.10.0PREDICTED: NAC domain-containing protein 62
TrEMBLA0A0D2MXG40.0A0A0D2MXG4_GOSRA; Uncharacterized protein
STRINGGorai.004G125900.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.15e-92NAC transcription factor-like 9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]