PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G102000.2
Common NameB456_004G102000, LOC105790962
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 369aa    MW: 40744.6 Da    PI: 6.168
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G102000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.61.1e-072061437
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg........H 37
                        ++C+++++  + +fC++++ ++C +C + +H+         H
  Gorai.004G102000.2 20 KTCDTCKSAAAAIFCRSDSAFMCLNCDSRIHSAndklvscrH 61
                        79*****************************65655555555 PP

2zf-B_box27.37.5e-0964109342
            zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                          ++C+ +e+ ++   C+ +   lC  C + +H+       H++vp+
  Gorai.004G102000.2  64 VWMCEVCEQAPAAVTCKADAAALCVACDSDIHSAnplarrHERVPV 109
                         689*****************************66899999*99986 PP

3CCT70.15.6e-24291335145
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                         Rea++lRY+eKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++e
  Gorai.004G102000.2 291 REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRSE 335
                         9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.1E-41759IPR000315B-box-type zinc finger
PROSITE profilePS501199.671766IPR000315B-box-type zinc finger
PfamPF006434.3E-52062IPR000315B-box-type zinc finger
CDDcd000214.57E-72266No hitNo description
SMARTSM003363.5E-1562109IPR000315B-box-type zinc finger
PROSITE profilePS5011910.80862109IPR000315B-box-type zinc finger
PfamPF006436.3E-764109IPR000315B-box-type zinc finger
CDDcd000211.89E-965109No hitNo description
PfamPF062035.7E-18291333IPR010402CCT domain
PROSITE profilePS5101716.817291333IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MVIDTTNVKG LTGRWGMAAK TCDTCKSAAA AIFCRSDSAF MCLNCDSRIH SANDKLVSCR  60
HERVWMCEVC EQAPAAVTCK ADAAALCVAC DSDIHSANPL ARRHERVPVQ PFFDSADSIV  120
KSSPFSFLVP TDPNTGSNCQ QEDVETGSWL LPNPKLTMET NQVKTGDFFF SDMDPFIDFE  180
YQDSFQQHDG AMDSVVPVQT KPATISMINN ENCFDVDFCR SKFPTFSYQT KSQSHSVSSS  240
SLEVGVVPDG NSVSDISYTL GRTMGDPSAP IWAATANNQA PPQAQVDGMD REARVLRYRE  300
KRKNRKFEKT IRYASRKAYA ESRPRIKGRF AKRSETDNEV DHMYNSASSA ATAAAFMYDN  360
QYGIVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM2020110.0KM202011.1 Gossypium raimondii CONSTANS-like 7 protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474241.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH81e-127COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0D2MWF10.0A0A0D2MWF1_G
STRINGPOPTR_0018s10510.11e-155(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-121CONSTANS-like 5
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Zhang R, et al.
    Molecular evolution and phylogenetic analysis of eight COL superfamily genes in group I related to photoperiodic regulation of flowering time in wild and domesticated cotton (Gossypium) species.
    PLoS ONE, 2015. 10(2): p. e0118669
    [PMID:25710777]