PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G097700.1
Common NameB456_004G097700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 155aa    MW: 17894 Da    PI: 4.5021
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G097700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.68.3e-11107149446
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                          k+++r  +NR A  rsR+RKk++++ Le k+  Le+e ++L 
  Gorai.004G097700.1 107 AKKQKRQLRNRDAVVRSRERKKMYVKDLEMKSRYLEGECRRLS 149
                         59************************************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.0E-10102149No hitNo description
PROSITE profilePS502179.071106148IPR004827Basic-leucine zipper domain
PfamPF001702.1E-9107149IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.88E-9108151No hitNo description
CDDcd147043.20E-13109154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MEEINWDTFF LEVDLLDFGD ILDNEPEQVT KPPPQPCSTQ NPDEEPTLSS WIEEIEKVLI  60
EDDNFDHMVE TQLSPPCSGS DIVGVDSGDL HKQSQTHTDV DKDNPIAKKQ KRQLRNRDAV  120
VRSRERKKMY VKDLEMKSRY LEGECRRLSH VLHC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447655.11e-77PREDICTED: bZIP transcription factor 60-like
TrEMBLA0A0D2MW251e-111A0A0D2MW25_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-09basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]