PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G075400.1
Common NameB456_004G075400, LOC105790671
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 421aa    MW: 46099.9 Da    PI: 6.3331
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G075400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.32e-14212266357
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         + kr+rr+ +NRe+ArrsR+RK+a + eLe  v +L  e ++L k l   + +++
  Gorai.004G075400.1 212 DAKRARRMRSNRESARRSRRRKQAHMNELEAQVGQLRVEHSTLLKSLTDTNHKYD 266
                         68******************************************88877666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.1E-10208261No hitNo description
SMARTSM003383.3E-17210274IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611212258IPR004827Basic-leucine zipper domain
PfamPF001706.0E-12213265IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.41E-10214263No hitNo description
PROSITE patternPS000360217232IPR004827Basic-leucine zipper domain
PfamPF124981.6E-23281398IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MHTEFSVDDF SDSFWAAPPG MSRSQSEWAF DNFIEEFSGS GGAIPVSRSG ESVIGPSLAE  60
PRPSVSKSEE ADGEGDVVEI KRPGNQNHNS PPSDLAPTFS IDSDEYRAIL KDKLHQACAA  120
VALSRASSVK AEVFSAQAED QALQSRSQVQ GSSKAQGQGE LDATPSEVLA MSTTQTKSKV  180
QMRQTTSVSS GEDSDDDELR DTETTDNMDP ADAKRARRMR SNRESARRSR RRKQAHMNEL  240
EAQVGQLRVE HSTLLKSLTD TNHKYDEAAV DNRILKADIE TLRAKVKMAE ETVKRVTGIN  300
FNSGLLSRHN VASVGMPFVS SPLETSSTAP VPLQPNTNQF FHQPVPLHHQ RMENGFMGNT  360
MVPPIVNSRT EGVKHVNETS ALQHTPRSER VQDQIGPGVS QRMSGWEPQQ HAAAKNKKQN  420
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1226233RRSRRRKQ
2228233SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473842.10.0PREDICTED: light-inducible protein CPRF2-like
TrEMBLA0A0D2MV150.0A0A0D2MV15_G
STRINGPOPTR_0005s23900.12e-78(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.18e-58basic leucine zipper 25
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]