PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G066000.2
Common NameB456_004G066000, LOC105790577
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 305aa    MW: 33596.8 Da    PI: 9.6344
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G066000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.53.9e-32141197158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         +ep+YVNaKQy++Il+RRq Rak+e ekk+ +k rkpylheSRh hA+rR+RgsgGrF
  Gorai.004G066000.2 141 EEPVYVNAKQYHGILRRRQIRAKAELEKKV-IKVRKPYLHESRHLHAMRRARGSGGRF 197
                         69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-36139200IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.039140200IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.0E-28142197IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.9E-24143165IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860145165IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.9E-24174197IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MPAKPRNEDQ RMHHGAQSVL NSTAYSEPWW KAVGIDLLGE AASKSPSAEK KNGPTADGDG  60
RNGHDEQYLK HVPSAAPLTL VEHLEPNSQM ELAGHSIVLK SYPCSDLQYS GILASYGPQI  120
MVSPLYGMHH ARMPLPLQME EEPVYVNAKQ YHGILRRRQI RAKAELEKKV IKVRKPYLHE  180
SRHLHAMRRA RGSGGRFLNK KKLDDHITSP NSEKGMNSDE NISAKSAHLS GFECLSSSGT  240
GNLSSFYGQQ EGNESLVKDL HKAQPLANST LHLSSNNAEK GNYFRQQRDI VQGNGAQHGA  300
PSIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-21141212274NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.31121e-144seedling
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5829182e-38JX582918.1 Gossypium hirsutum clone NBRI_GE15843 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473703.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012473704.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like
TrEMBLA0A0D2R0820.0A0A0D2R082_GOSRA; Uncharacterized protein
STRINGGorai.004G066000.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.34e-44nuclear factor Y, subunit A1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]