PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G061000.3
Common NameB456_004G061000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 407aa    MW: 44432 Da    PI: 4.9701
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G061000.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box171.3e-05444539
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                        +C+ +++++   +C+++  +lC +C  + H+       H++
  Gorai.004G061000.3  4 NCDFCGHQRPVVYCRSDAACLCLSCDRNVHSAnalsrrHSR 44
                        6*****************************65677777766 PP

2zf-B_box23.89.3e-084689441
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvp 41
                          C++++++++   C++ ++ lCe+C   +H g       H++++
  Gorai.004G061000.3 46 LLCERCNSQPALVRCTEERVSLCENCDWIGH-GtstsnstHKRQT 89
                        57*****************************.5578888888766 PP

3CCT62.71.1e-21349392144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R +a++RYkeK+ktRkFeK++rY+sRKa+A+ R+RvKGrFvk+ 
  Gorai.004G061000.3 349 RSNAVMRYKEKKKTRKFEKRVRYASRKARADVRKRVKGRFVKAG 392
                         899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.3547IPR000315B-box-type zinc finger
CDDcd000211.32E-7547No hitNo description
SMARTSM003361.1E-8547IPR000315B-box-type zinc finger
PROSITE profilePS501198.9164390IPR000315B-box-type zinc finger
CDDcd000219.61E-54790No hitNo description
SMARTSM003361.54890IPR000315B-box-type zinc finger
PfamPF062033.0E-16349391IPR010402CCT domain
PROSITE profilePS5101715.448349391IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MGYNCDFCGH QRPVVYCRSD AACLCLSCDR NVHSANALSR RHSRTLLCER CNSQPALVRC  60
TEERVSLCEN CDWIGHGTST SNSTHKRQTI NCYSGCPSSA ELSSLWPFFW QSPSPGESTC  120
EKELGLMSIT ENIETTSWGP TGNTVSQNKN SAGVAEVNND NNADMGSGWD GSSSILELRS  180
PPLALDQPAG VTDTSLPKVS CPQTKRPSLY EDDLYDDFNM DEVDLNLDNY EELFGVALNH  240
SEELFESGGI DSLFRTNDLS AADSDCRGAV AAEPACSNGA SADSVMSNKT DSVLCFTGRQ  300
AHSSLSFSGL TGESSGADYQ DCGASSMLLM GEPPWCPPCT ESSFQSSTRS NAVMRYKEKK  360
KTRKFEKRVR YASRKARADV RKRVKGRFVK AGDAYDYDPL NQTQSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473618.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_012473617.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_012473616.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_012473615.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE51e-147COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A0D2QZX70.0A0A0D2QZX7_G
STRINGGLYMA13G11592.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-121CONSTANS-like 9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]