PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G054700.1
Common NameB456_004G054700, LOC105790465
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 248aa    MW: 27710.1 Da    PI: 7.4519
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G054700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.73.5e-141150342
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        i ++s r+ t+ kR +g++KK +ELS LC+++++ i+fs+
  Gorai.004G054700.1 11 ITDDSTRKATYKKRTKGLMKKLSELSSLCGIDACSIMFSP 50
                        8899***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.5E-17160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.465149IPR002100Transcription factor, MADS-box
CDDcd002663.23E-28285No hitNo description
PRINTSPR004046.3E-5323IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-21494IPR002100Transcription factor, MADS-box
PfamPF003199.0E-161151IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MTGKKIKLAY ITDDSTRKAT YKKRTKGLMK KLSELSSLCG IDACSIMFSP YESQPKVWPS  60
PMGVQQVLSK LETIPEMEKN KNMLNQESFL SQKTTKAAEQ LKKHCKENWE KEMTHVMFNT  120
ICGKGVIHGL NFEALSEINL LLDKKMSDID KRIDALAKTP LNPQGVSSSS SSSLVALPPM  180
KMVMPEAMPM TGTEDIVQAD VNEMDPMQRE QWIMELMSNN NNNPQTHVGD NGMMFQFGDN  240
INPNNGL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11631RKATYKKRTKGLMKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473527.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0D2RU000.0A0A0D2RU00_GOSRA; Uncharacterized protein
STRINGGorai.004G054700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.17e-47AGAMOUS-like 80
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]