PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G050400.1
Common NameB456_004G050400, LOC105790423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 143aa    MW: 15992.2 Da    PI: 10.0025
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G050400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.12.2e-142583563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        ++ +r+ +NRe+ArrsR +K++ +e L ++v  L++eN++L ke++  ++ + +++s +
  Gorai.004G050400.1 25 RKRKRMLSNRESARRSRMKKRKLMEDLGNEVSLLQKENSRLSKEINASTQRYIEMESAN 83
                        57899*********************************************999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-152185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.2432386IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-122373No hitNo description
SuperFamilySSF579594.56E-122579No hitNo description
PfamPF001701.1E-112583IPR004827Basic-leucine zipper domain
CDDcd147024.75E-162676No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MAASVQRPAS SGSESDPRNA NIDERKRKRM LSNRESARRS RMKKRKLMED LGNEVSLLQK  60
ENSRLSKEIN ASTQRYIEME SANNLLRAEA MGLTERLRSL NSVLHIVEEV NGHAVEIPEI  120
PDDPLLKPLV VAVPEANYGV SR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12645RKRMLSNRESARRSRMKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473462.15e-97PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP81e-44BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A0D2QZ985e-97A0A0D2QZ98_G
STRINGPOPTR_0014s11590.14e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.18e-46basic region/leucine zipper motif 53
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]