PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G048200.1
Common NameB456_004G048200, LOC105790399
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 608aa    MW: 69181.9 Da    PI: 5.095
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G048200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM184.42.6e-5761331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeelvv+yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratksgyWkatgkd
  Gorai.004G048200.1   6 LPPGFRFHPTDEELVVYYLKRKINGRKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKSGYWKATGKD 95 
                         79****************************.99***************6434555777********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v s ++++vg+kktLv+y+grap+g++t+Wvmheyrl
  Gorai.004G048200.1  96 RKVNS-QTRAVGMKKTLVYYRGRAPHGTRTNWVMHEYRL 133
                         *****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-653157IPR003441NAC domain
PROSITE profilePS5100561.7816157IPR003441NAC domain
PfamPF023651.3E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MGAVSLPPGF RFHPTDEELV VYYLKRKING RKIELEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKSGYWK ATGKDRKVNS QTRAVGMKKT LVYYRGRAPH  120
GTRTNWVMHE YRLDERECES ASLGLQDAYA LCRVFKKTAI PPKVPGDHYQ AVATPNQIAY  180
EHSSSFEESS DFGIPIDTRS PSVLNRSPID ICDANEVKWM QSLSHDVFGL NNASFTNYET  240
LPYHPSKVDV ALECARLQHR LALPPLEVED FPRLGFTNYK LMETTPPPPP TRETDILQEI  300
LSLNPIGHED AWGASSSNNN ADDFTFMTAK SMYQNQVNEM SCAQYMNKPL EEAITRPIDI  360
TELQGERMAE NSRWVGMSSK DLEQYCFMEE NKVVPIENIS SFTRNEDNGI QGNGHDYNSF  420
EFDDTGINNP EMEDFTHGFI DDDPNDHHFL DEGNMDDLTT SPSFELVEDI KINHGMFVST  480
RQVANTFFHQ TLPSQTVQVH QNAMTPTSFH FQVEKHKGKC MATTMSTFTR QCKEALSGFL  540
CMLVLLLYVG EEDDGLNGGS KECNKEKEVT DYLLIKSKAS SWNDFGLVWK KLGFFFTISL  600
VLCTLLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-58415915167NO APICAL MERISTEM PROTEIN
1ut4_B5e-58415915167NO APICAL MERISTEM PROTEIN
1ut7_A5e-58415915167NO APICAL MERISTEM PROTEIN
1ut7_B5e-58415915167NO APICAL MERISTEM PROTEIN
3swm_A5e-58415918170NAC domain-containing protein 19
3swm_B5e-58415918170NAC domain-containing protein 19
3swm_C5e-58415918170NAC domain-containing protein 19
3swm_D5e-58415918170NAC domain-containing protein 19
3swp_A5e-58415918170NAC domain-containing protein 19
3swp_B5e-58415918170NAC domain-containing protein 19
3swp_C5e-58415918170NAC domain-containing protein 19
3swp_D5e-58415918170NAC domain-containing protein 19
4dul_A5e-58415915167NAC domain-containing protein 19
4dul_B5e-58415915167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473428.10.0PREDICTED: NAC domain-containing protein 86
TrEMBLA0A0D2RTJ80.0A0A0D2RTJ8_GOSRA; Uncharacterized protein
STRINGGorai.004G048200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101122632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-149NAC domain containing protein 28
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]