PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G030300.1
Common NameB456_004G030300, LOC105790222
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 314aa    MW: 34241.3 Da    PI: 6.426
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G030300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box315.3e-102462341
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkgHtvvp 41
                        +++C+ +++  + +fC+++ ++lC +C ++ H+gH++v+
  Gorai.004G030300.1 24 AKTCDACKSSAAAIFCRTDWVFLCLNCDSNFHSGHERVS 62
                        579******99*************************987 PP

2zf-B_box26.31.5e-0862106442
            zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                          +C+ +e+ ++   C+ +   lC +C   +H+       H++vp+
  Gorai.004G030300.1  62 SMCEVCEQAPAAVTCKADAAALCVTCDADIHSAnplarrHERVPI 106
                         68*****************************66899999*99997 PP

3CCT70.83.5e-24235278144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRYkeKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  Gorai.004G030300.1 235 REARVLRYKEKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 278
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.0542263IPR000315B-box-type zinc finger
SMARTSM003361.7E-82263IPR000315B-box-type zinc finger
PfamPF006438.3E-82562IPR000315B-box-type zinc finger
CDDcd000213.93E-72763No hitNo description
PROSITE profilePS5011911.20659106IPR000315B-box-type zinc finger
PfamPF006438.9E-761106IPR000315B-box-type zinc finger
CDDcd000211.04E-863106No hitNo description
SMARTSM003367.1E-1164106IPR000315B-box-type zinc finger
PfamPF062033.1E-18235277IPR010402CCT domain
PROSITE profilePS5101716.668235277IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGIEISGGTI IPGGWGAAAM AVAAKTCDAC KSSAAAIFCR TDWVFLCLNC DSNFHSGHER  60
VSMCEVCEQA PAAVTCKADA AALCVTCDAD IHSANPLARR HERVPIEPFY DSADSIVKSS  120
PFSFLVPTTD HNGTNCKQEI ESNKGDFFFT EMDRFIDFGY PNSSQHLHDA AMDSVVPVQT  180
PKPVIPLIND GSCFDTFSYQ TQSSLSHSVS SSSLEVGTVP DGNYHATQVG GSIDREARVL  240
RYKEKRKNRK FEKTIRYASR KAYAESRPRI KGRFAKRTET HNDDVDHMFN NSSFAVGPAG  300
FMAETDYGVV PSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.23920.0flower|seedling| flowering
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6183310.0JQ618331.1 Gossypium hirsutum constans-like protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473161.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH81e-104COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0D3R2530.0A0A0D3R253_G
TrEMBLA0A0D3R2Y40.0A0A0D3R2Y4_G
TrEMBLA0A0D3R2E20.0A0A0D3R2E2_G
TrEMBLA0A0D3R2G20.0A0A0D3R2G2_G
TrEMBLA0A0D3R2I10.0A0A0D3R2I1_G
TrEMBLA0A0D3R3410.0A0A0D3R341_G
TrEMBLA0A0D3R2F50.0A0A0D3R2F5_G
TrEMBLA0A0D2MSU70.0A0A0D2MSU7_G
TrEMBLA0A0D3R3250.0A0A0D3R325_G
TrEMBLW5QLX80.0W5QLX8_G
TrEMBLA0A0D3R2X70.0A0A0D3R2X7_G
STRINGPOPTR_0018s10510.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2440334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-102CONSTANS-like 5
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Zhang R, et al.
    Molecular evolution and phylogenetic analysis of eight COL superfamily genes in group I related to photoperiodic regulation of flowering time in wild and domesticated cotton (Gossypium) species.
    PLoS ONE, 2015. 10(2): p. e0118669
    [PMID:25710777]