PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G023900.1
Common NameB456_004G023900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 121aa    MW: 12897.9 Da    PI: 9.0761
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G023900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26067.43.3e-2143103161
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamssl 61 
                         +C aCk+lrr+Ca++Cvlapyfp ++p+kfa++h++FGasn++k+l+  +++  e+ ++s+
  Gorai.004G023900.1  43 PCVACKILRRRCADKCVLAPYFPPTEPAKFAIAHRVFGASNIIKFLQVPSTSPAENQLTSV 103
                         7*********************************************987666666665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.42542120IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-2043102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MEYSEPIPTP TISSSPSLSP NSLISSNSPP SPPLSPPLVV ISPCVACKIL RRRCADKCVL  60
APYFPPTEPA KFAIAHRVFG ASNIIKFLQV PSTSPAENQL TSVVKKKPHC TDSLNQTTQQ  120
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6169072e-45JX616907.1 Gossypium hirsutum clone NBRI_GE61864 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462233.12e-35PREDICTED: LOB domain-containing protein 1-like
TrEMBLA0A0D2MSI33e-80A0A0D2MSI3_G
STRINGVIT_13s0019g03700.t017e-30(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2065446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-28LOB domain-containing protein 11
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]