PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G180600.1
Common NameB456_003G180600, LOC105789338
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 328aa    MW: 37368.5 Da    PI: 5.6265
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G180600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.5e-5361331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeel+ +yLk+k+eg ++el evi+ +d+yk++PwdLp k  + +++ ew+fF++rd+ky++g+r+nratk+gyWkatgkd
  Gorai.003G180600.1   6 LPPGFRFHPTDEELIGYYLKRKTEGLEIEL-EVIPVIDLYKFDPWDLPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATKAGYWKATGKD 95 
                         79****************************.99**************95334445667********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v++ ++++ g +ktLvfy+grap g +tdWvmheyrl
  Gorai.003G180600.1  96 RNVVC-QSAVSGYRKTLVFYQGRAPLGDRTDWVMHEYRL 133
                         *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-593154IPR003441NAC domain
PROSITE profilePS5100557.8746154IPR003441NAC domain
PfamPF023656.4E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGGPSLPPGF RFHPTDEELI GYYLKRKTEG LEIELEVIPV IDLYKFDPWD LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATKAGYWK ATGKDRNVVC QSAVSGYRKT LVFYQGRAPL  120
GDRTDWVMHE YRLSDQPETS TNQGAYALCH VMKRNESKAS DTNGEFRATR VKTRSTNTKL  180
TSTWTCNKPL STSGDISCQT CYPNSESHYS SPITSPPHDV TQLQPFEPIS VNIDLANVWL  240
SPDLILDSSK DYPQICETAA QYFPQYEFPS TLTPWQQYEH SNFSPSTLYS NFGEIEHVND  300
LGLYSGHANN MDFYDNEGYG QIGSFNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-52515716168NO APICAL MERISTEM PROTEIN
1ut4_B6e-52515716168NO APICAL MERISTEM PROTEIN
1ut7_A6e-52515716168NO APICAL MERISTEM PROTEIN
1ut7_B6e-52515716168NO APICAL MERISTEM PROTEIN
3swm_A8e-52515719171NAC domain-containing protein 19
3swm_B8e-52515719171NAC domain-containing protein 19
3swm_C8e-52515719171NAC domain-containing protein 19
3swm_D8e-52515719171NAC domain-containing protein 19
3swp_A8e-52515719171NAC domain-containing protein 19
3swp_B8e-52515719171NAC domain-containing protein 19
3swp_C8e-52515719171NAC domain-containing protein 19
3swp_D8e-52515719171NAC domain-containing protein 19
4dul_A6e-52515716168NAC domain-containing protein 19
4dul_B6e-52515716168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472120.0KC847212.1 Gossypium hirsutum NAC domain protein NAC35 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314300.10.0NAC domain-containing protein 86
RefseqXP_012472134.10.0PREDICTED: NAC domain-containing protein 86-like
SwissprotO496971e-106NAC71_ARATH; NAC domain-containing protein 71
TrEMBLA0A0D2RPN00.0A0A0D2RPN0_GOSRA; Uncharacterized protein
TrEMBLW6J8X50.0W6J8X5_GOSHI; NAC domain protein NAC35
STRINGGorai.003G180600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21512777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-108NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  4. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]