PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G169000.2
Common NameB456_003G169000, LOC105789230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 367aa    MW: 42408.3 Da    PI: 7.0181
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G169000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.12.8e-5671361129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv++yL+kk+++kk++l +vik+vd+yk+ePwdL++  ++ + e++ewyfFs++dkky+tg+r+nratk+g+Wkatg+
  Gorai.003G169000.2   7 VPPGFRFHPTDEELVNYYLRKKIASKKIDL-DVIKDVDLYKIEPWDLQElcRIGSeEQNEWYFFSHKDKKYPTGTRTNRATKAGFWKATGR 96 
                         69****************************.9***************954555552556******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk+++s + +l+g++ktLvfykgrap+g+k+dW+mheyrle
  Gorai.003G169000.2  97 DKPIYS-RLSLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                         ******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-615156IPR003441NAC domain
PROSITE profilePS5100560.2697156IPR003441NAC domain
PfamPF023651.2E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VNYYLRKKIA SKKIDLDVIK DVDLYKIEPW DLQELCRIGS  60
EEQNEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKPI YSRLSLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GTPQEEGWVV CRVFKKRMTT VRKMGEYESS CWYDDQVSFI  180
QELESPRRIT QPYVAAAATT YHHHHHFPCK QELELQYNFP HDPFLQLPQL ESPKVPQSTA  240
PSISCNSVIP YNGTSTLQSS TLTHEEHLHN LNSLYNNNTI DQQQQAVDQV TDWRVLDKFV  300
ASQLSHEEGS KENNYTTNAA AAAATSYHVA EQINLPTNES KRADIGHHHQ EYASTSTSSC  360
QIDLWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-51615714169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root, shoot and hypocotyl vascular elements, columella root caps, epidermal and cortex root cells and root-hypocotyl junctions. Observed predominantly in root imature xylem vessels (PubMed:18445131). Present in root developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472250.0KC847225.1 Gossypium hirsutum NAC domain protein NAC48 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471965.10.0PREDICTED: NAC domain-containing protein 7 isoform X1
SwissprotQ9FWX21e-159NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0D2QM170.0A0A0D2QM17_GOSRA; Uncharacterized protein
STRINGGorai.003G169000.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-136NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]