PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G150700.1
Common NameB456_003G150700, LOC105789043
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family WRKY
Protein Properties Length: 574aa    MW: 62666.4 Da    PI: 7.4737
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G150700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.72.5e-33234291260
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                         dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Gorai.003G150700.1 234 DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGSHNHPK 291
                         8****************************************.***************85 PP

2WRKY106.81.1e-33406464159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d k+v++tYeg+Hnh+
  Gorai.003G150700.1 406 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLKAVITTYEGKHNHD 464
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.3E-28223292IPR003657WRKY domain
SuperFamilySSF1182901.96E-25232292IPR003657WRKY domain
SMARTSM007741.3E-36233291IPR003657WRKY domain
PROSITE profilePS5081123.824234292IPR003657WRKY domain
PfamPF031061.2E-25234290IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.3E-38391466IPR003657WRKY domain
SuperFamilySSF1182901.28E-29398466IPR003657WRKY domain
PROSITE profilePS5081138.17401466IPR003657WRKY domain
SMARTSM007741.3E-39406465IPR003657WRKY domain
PfamPF031064.7E-26407464IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MASSYDTSAN SLPQNAFGFS THPFMTTSFS DLLASGTTDD DNSSSAVNHG KRGGGLSLSD  60
RIAERTGSGV PKFKSLPPPS LPISPPPVSP SSYFAIPAGL SPAELLDSPV LLNSSNILPS  120
PTTGTFPAQA FNWKPSSGNN QQNVKRVDKS YTDFSFQTFQ SSTNTNQTAQ QEAWSFKESV  180
KEADFSSGKN MVKSEYNQMQ SFSPEIANIQ SCQSDYTNYQ HQQSQSLRGN RKSDDGYNWR  240
KYGQKQVKGS ENPRSYYKCT YPNCPTKKKV ERSLDGQITE IVYKGSHNHP KPQSTRRSSS  300
SSSSSIAIQA SSAATSEIPD HSFISHGSGH MDSAATPENS SISVGDDDFD RGSQKSKSGG  360
DEFDEDEPDA KRWRGEGETE GISAPGSRTV REPRVVVQTT SDIDILDDGY RWRKYGQKVV  420
KGNPNPRSYY KCTHPGCPVR KHVERASHDL KAVITTYEGK HNHDVPAARG SGGHSVNRPL  480
PDNNNNNGAM AIRPSPLNNP MSNNQALRGL RQSTTEGESP FMLEMFQGNG NLGFSGFGNS  540
GGSIMNQQHD VHNMFSRTKE EPRDEAFIES LLY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-37234467878Probable WRKY transcription factor 4
2lex_A1e-37234467878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In dry seeds, expressed in aleurone cells and embryos. Levels drop rapidly but transiently in the embryos of imbibed seeds. {ECO:0000250|UniProtKB:Q6IEQ7}.
UniprotTISSUE SPECIFICITY: Expressed in aleurone cells. Mostly expressed in aleurone layers and leaves, and, to a lower extent, in roots, panicles and embryos. {ECO:0000250|UniProtKB:Q6IEQ7}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6698580.0KF669858.1 Gossypium hirsutum WRKY transcription factor 18 (WRKY18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314201.10.0probable WRKY transcription factor 25
RefseqXP_012471694.10.0PREDICTED: probable WRKY transcription factor 25
SwissprotQ6B6R41e-142WRK24_ORYSI; WRKY transcription factor WRKY24
TrEMBLA0A068LDC30.0A0A068LDC3_GOSHI; WRKY transcription factor 18
TrEMBLA0A0D2P1V00.0A0A0D2P1V0_GOSRA; Uncharacterized protein
STRINGGorai.003G150700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-112WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]