PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G149600.1
Common NameB456_003G149600, LOC105789033
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 177aa    MW: 19610.2 Da    PI: 6.6123
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G149600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.66e-4571061100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+
  Gorai.003G149600.1   7 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVQQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQ 97 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          +la++++e
  Gorai.003G149600.1  98 MQLAVAQTE 106
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.056107IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-447104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGSGSSPCAS CKLLRRRCAK DCIFAPYFPS DDPHKFAIVH KVFGASNVSK MLQELPVQQR  60
ADAVSSLVYE ANARVRDPVY GCVGAISYLQ NQVSQLQMQL AVAQTEILCI QMQHHQEDSA  120
LALPTQMQHH DDDDYKPFLL PTTHNLDNIS QYINFASSSN VIQDPAATVK RESLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471684.11e-131PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW38e-78LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0D2QTT21e-131A0A0D2QTT2_G
STRINGVIT_06s0004g07200.t013e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-79LBD family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]