PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G142600.2
Common NameB456_003G142600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 249aa    MW: 27156 Da    PI: 10.6495
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G142600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.81.5e-18163197135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +C +tkTp+WR+gp g+ktLCnaCG+++r+ +l
  Gorai.003G142600.2 163 CLHCEVTKTPQWREGPMGPKTLCNACGVRFRSGRL 197
                         99*****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.5E-17157211IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.372157193IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.9E-14161220No hitNo description
Gene3DG3DSA:3.30.50.102.5E-14161194IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.20E-14162209No hitNo description
PfamPF003202.0E-16163197IPR000679Zinc finger, GATA-type
PROSITE patternPS003440163188IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MFSPACLPDF LCDGSSQLNQ WSSVTEASSG RSVTLHSEST DVKGSIRFQT SSPVSVLESS  60
STCSAANPVP INPKLGFLVK RGRSKRRRAS AFNVHFTLPF TSSTSSTSRG SNSSVGSESE  120
SESHLTEEPA KKRLKKKMNL TWLSDFSEMK KSPSRQPIEV RKCLHCEVTK TPQWREGPMG  180
PKTLCNACGV RFRSGRLLPE YRPAASPTFV PALHSNSHKK VVEMRKQANL PMTGTPPMLS  240
IPQAPISM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471520.11e-149PREDICTED: GATA transcription factor 11-like isoform X1
SwissprotQ6DBP82e-50GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A0D2QTF30.0A0A0D2QTF3_G
STRINGPOPTR_0004s22140.18e-59(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.24e-41GATA transcription factor 11
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]