PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G114100.2
Common NameB456_003G114100, LOC105788606
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 295aa    MW: 34598.7 Da    PI: 6.9193
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G114100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1775.1e-5571361129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eelv++yL+kk++ ++++l +vik+vd+yk+ePwdL++  ++   e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+
  Gorai.003G114100.2   7 VPPGFRFHPTEEELVDYYLRKKISLRRIDL-DVIKDVDLYKIEPWDLQEicRIGReEQNEWYFFSHKDKKYPTGSRTNRATAAGFWKATGR 96 
                         69****************************.9***************954544432566******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk+++s k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  Gorai.003G114100.2  97 DKAIYS-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                         ******.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-604156IPR003441NAC domain
PROSITE profilePS5100558.7747156IPR003441NAC domain
PfamPF023655.2E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MNVLPQVPPG FRFHPTEEEL VDYYLRKKIS LRRIDLDVIK DVDLYKIEPW DLQEICRIGR  60
EEQNEWYFFS HKDKKYPTGS RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETYEN GTPQDEGWVV CRVFKKRITA MRKVGEHESS CWYDDQVSFI  180
PDLDSPNQTS LSNNAYHHLP YSCKKELDLQ YQVPHDHYLQ SRDPLSCNPM AAFGQCSSFT  240
QDHHIQQTHH QHLNALFGNH SNEQAVDQAT DWRLLDTLVA SQLSQEEEIY RQSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-49716217171NO APICAL MERISTEM PROTEIN
1ut4_B1e-49716217171NO APICAL MERISTEM PROTEIN
1ut7_A1e-49716217171NO APICAL MERISTEM PROTEIN
1ut7_B1e-49716217171NO APICAL MERISTEM PROTEIN
3swm_A1e-49716220174NAC domain-containing protein 19
3swm_B1e-49716220174NAC domain-containing protein 19
3swm_C1e-49716220174NAC domain-containing protein 19
3swm_D1e-49716220174NAC domain-containing protein 19
3swp_A1e-49716220174NAC domain-containing protein 19
3swp_B1e-49716220174NAC domain-containing protein 19
3swp_C1e-49716220174NAC domain-containing protein 19
3swp_D1e-49716220174NAC domain-containing protein 19
4dul_A1e-49716217171NAC domain-containing protein 19
4dul_B1e-49716217171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root, shoot and hypocotyl vascular elements, columella root caps, epidermal and cortex root cells and root-hypocotyl junctions. Observed predominantly in root imature xylem vessels (PubMed:18445131). Present in root developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471021.10.0PREDICTED: NAC domain-containing protein 7
RefseqXP_012471022.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-123NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0D2MMJ70.0A0A0D2MMJ7_GOSRA; Uncharacterized protein
STRINGGorai.003G114100.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-122NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]