PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G093300.1
Common NameB456_003G093300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 167aa    MW: 18624.1 Da    PI: 10.545
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G093300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.12.9e-33965158
           CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                        +ep+YVNaKQy++Il+RRq+Rak+e ekkl +k rkpylheSRh hA+rR+Rg+gGrF
  Gorai.003G093300.1  9 EEPVYVNAKQYHGILRRRQSRAKAELEKKL-IKVRKPYLHESRHLHAMRRARGCGGRF 65
                        69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-37768IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.337868IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.1E-281065IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.7E-241133IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068601333IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.7E-244265IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MALPLEMAEE PVYVNAKQYH GILRRRQSRA KAELEKKLIK VRKPYLHESR HLHAMRRARG  60
CGGRFLNTKK LGTDASNAVP NRGSDSASSN LSSVGHGESK ESQLQGTNNQ QQALSNANGC  120
YPHHERFLFS TSGSLSDKMM EGDCPRQQQR ERIMANQVPH MALTIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-21980277NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472445.11e-120PREDICTED: nuclear transcription factor Y subunit A-7-like, partial
TrEMBLA0A0D2QQN31e-120A0A0D2QQN3_GOSRA; Uncharacterized protein
STRINGGorai.003G093300.11e-121(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156021015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.12e-35nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]