PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G073300.1
Common NameB456_003G073300, LOC105788148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 636aa    MW: 70808.1 Da    PI: 4.7713
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G073300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.25.4e-5291351127
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lp GfrF+Ptdeel+++yL+ k++g++ e+  vi+e+d++k+ePwdLp  + +k+++ ew+fF++ d+ky++++r+nrat++gyWkatgkd
  Gorai.003G073300.1   9 LPLGFRFRPTDEELINHYLRLKINGRHSEV-GVIPEIDVCKWEPWDLPglSVIKSDDPEWFFFCPLDRKYPNSHRSNRATDKGYWKATGKD 98 
                         699************************999.99***************6447888888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                         ++++s k++l+g+kktLvfykgrapkg++t W+mheyr
  Gorai.003G073300.1  99 RTIKS-KKSLIGMKKTLVFYKGRAPKGQRTYWIMHEYR 135
                         *****.899****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-604159IPR003441NAC domain
PROSITE profilePS5100555.4269159IPR003441NAC domain
PfamPF023651.2E-2610135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MAVLTMETLP LGFRFRPTDE ELINHYLRLK INGRHSEVGV IPEIDVCKWE PWDLPGLSVI  60
KSDDPEWFFF CPLDRKYPNS HRSNRATDKG YWKATGKDRT IKSKKSLIGM KKTLVFYKGR  120
APKGQRTYWI MHEYRPTTED LDGTAPGQSA FVLCRLFHKP EEKNDIVKYD EVEQTVCSAA  180
MTKSAPDDDT SSDLLQDTIS SETQAQNPDT SMRNGQITGD SCCNSHMTSD AEDHAAEETL  240
KYPLLGSNSD LYEPNCDEID YKVFSPMNSH FFEDLPPYMD SPYASDFGHD QNGFHFQDGT  300
SKQDISFPLL DEALNNRANF SEESNSWKNL VAGTEMPLSG NAFISKAMPP ETSYVKENGI  360
YTEMLPVQYE SDVGGPGWPG GFVDDKNSVQ MLTSLESSLT QTGPYDPVFI GGHIGGPENY  420
CVGQATSSTN SAIGDFNNLQ QLTSLRNHVN NGGVTGMRTT AYQPLQQPLE DYETLGTGFN  480
FRTRGPQEKP SLDNILNQGN APRRLRLLMK ISNGPMKVSA GCFDDGKLTS AGLGEEEEVQ  540
STLTEVTEAE ATGQTSSSDE SKKENQLFKF TSSEDIGKEP CTKLRQRVKE DSKPCSSQMC  600
SKAEPMHKRS SSLSVLLLVF FIITILFILV TGIWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-43916215171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470354.10.0PREDICTED: protein NTM1-like 9 isoform X1
TrEMBLA0A0D2QPM30.0A0A0D2QPM3_GOSRA; Uncharacterized protein
STRINGGorai.003G073300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.11e-124NAC transcription factor-like 9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]