PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G072300.1
Common NameB456_003G072300, LOC105788131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 667aa    MW: 73079 Da    PI: 8.4173
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G072300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.16.5e-3094178187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+laL+++r++m+  +r++  k+plWe+vs+k++e g++rs+k+Ckek+en++k+yk++k+g+++r++++s  +++f++lea
  Gorai.003G072300.1  94 RWPRQETLALLKIRSDMDGIFRDATVKGPLWEDVSRKLAELGYKRSAKKCKEKFENVHKYYKRTKDGRGGRQDGKS--YKFFSELEA 178
                         8*********************************************************************866665..******985 PP

2trihelix110.11.4e-34489574187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k evlaLi++r+ +e+r++++  k+plWee+s+ m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+ +tcpyf+ql+a
  Gorai.003G072300.1 489 RWPKAEVLALINLRSGLETRYQEAGPKGPLWEEISAGMSRMGYKRSAKRCKEKWENINKYFKKVKESNKKR-PEDAKTCPYFHQLDA 574
                         8*********************************************************************8.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.01691153IPR001005SANT/Myb domain
CDDcd122033.26E-2693158No hitNo description
PfamPF138377.9E-2193179No hitNo description
PROSITE profilePS500906.59793151IPR017877Myb-like domain
SMARTSM007170.0083486548IPR001005SANT/Myb domain
PfamPF138378.8E-24488575No hitNo description
PROSITE profilePS500906.748488546IPR017877Myb-like domain
CDDcd122032.93E-29488553No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MQQGGGGEGH QSQYGEVGGG PTTDATSSSH MVSEQTEQLE EASPISYRPP AAAIGNPDEL  60
MMRLAEEGDE GDRLGGDHGG GVGGGAGGVA SGNRWPRQET LALLKIRSDM DGIFRDATVK  120
GPLWEDVSRK LAELGYKRSA KKCKEKFENV HKYYKRTKDG RGGRQDGKSY KFFSELEALN  180
TTSATLSKPP ITLATSASLD VAPISVGIPM PISSVWIPPT TTTTTAIPMS SSMLPMPGSA  240
PPPPPATPFG ISFSSNSSSS SQGFEDEDEI GREPSTDMGG SSRKRKRQSS SREGGSSSSS  300
RKRMMEFFEG LMKQVMQKQE ALQQTFLESI EKREQDRMIR EEAWKRQEMA RLAREHELIA  360
QERAIASSRD AAIISFLQKI TGQTIQLPTT VSTIPSVPPP PTQPATPVVQ PPTPIPTAAS  420
PLHHPPSLPQ QKSHLHHQQQ QQAQNTQLVV KHNQQQEPIP SEVIMAIPEQ KVPPQEIGGS  480
EGIKPASSRW PKAEVLALIN LRSGLETRYQ EAGPKGPLWE EISAGMSRMG YKRSAKRCKE  540
KWENINKYFK KVKESNKKRP EDAKTCPYFH QLDALYRKKI LGSGSSSFSD QNRFEGETSQ  600
QHLDPPMEAP QPSHDQSENK TGTTIDVLTS KENSPGSLFG KGNGRATKKS EDIVRELMEE  660
QEMQMQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136144KRSAKKCKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470321.10.0PREDICTED: trihelix transcription factor GTL1
TrEMBLA0A0D2QGT90.0A0A0D2QGT9_GOSRA; Uncharacterized protein
STRINGGorai.003G072300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62262746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.14e-52GT-2-like 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]