PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G070700.1
Common NameB456_003G070700, LOC105788114
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 297aa    MW: 33530.4 Da    PI: 5.8032
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G070700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.72.3e-3910108199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC ++C lapyfpa+q+k f+n+hklFG+sn++k+l++l+++++ +am+s+ y+A++r r PvyG++gvi++l  q++ l+
  Gorai.003G070700.1  10 ACAACKYQRRKCIPECLLAPYFPADQTKVFQNAHKLFGVSNIVKILRSLDPSQHAEAMRSIKYQANVRDRFPVYGCLGVIRQLYYQIQMLE 100
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         +e++++ +
  Gorai.003G070700.1 101 EEMHTVLT 108
                         **998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.2749110IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-3710106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MTLKGGATSA CAACKYQRRK CIPECLLAPY FPADQTKVFQ NAHKLFGVSN IVKILRSLDP  60
SQHAEAMRSI KYQANVRDRF PVYGCLGVIR QLYYQIQMLE EEMHTVLTQL EMYRQHHHHQ  120
QQQQQHQHQH QISSMADDVI SQLELGMAPS NNALPLFNQV THQPYTMQNT YSSSDIDSPP  180
KDNVENNSLW IQHLFFDTNN HGTSNNDSPI AIQSQLLVPN SEPLADTQHQ VVQDYDEIHP  240
FFDSIDDRQS YIDTKDAEDS SSSEESLKET TQLMVGNVGS KDLKSAAACF SLTSVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3933921e-57GQ393392.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS0357 SSR marker CGR5281 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470302.10.0PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS62e-59LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A0D2RIA50.0A0A0D2RIA5_G
STRINGPOPTR_0012s07390.11e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.14e-60LOB domain-containing protein 27
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]