PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G058900.1
Common NameB456_003G058900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 140aa    MW: 16549.6 Da    PI: 5.4554
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G058900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26063.84.3e-209832296
              DUF260 22 fpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96
                        f ++++++f+n+hklFG+sn++k++k+ ++ e++++m+++v++++ +a+d v G++++i++l +q+e ++ael+l
  Gorai.003G058900.1  9 FLHDRQRQFQNAHKLFGVSNITKIIKNFNPPEKDIVMHTMVFQSDTQANDSVGGCYRIIQELPHQIEYSQAELEL 83
                        457999*****************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.554188IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-18982IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MRYRVHFPFL HDRQRQFQNA HKLFGVSNIT KIIKNFNPPE KDIVMHTMVF QSDTQANDSV  60
GGCYRIIQEL PHQIEYSQAE LELDFGCDSN LGYEMVKLDL LNLNYYYIQE PQEKQFVVDD  120
HSNNNQHLLQ ETYDHLWGI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012453880.12e-54PREDICTED: LOB domain-containing protein 22-like
SwissprotQ9LRW12e-31LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A0D2RHE01e-102A0A0D2RHE0_G
STRINGPOPTR_0001s20110.13e-32(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-32LOB domain-containing protein 22
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]