PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G032100.1
Common NameB456_003G032100, LOC105787696
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 188aa    MW: 21723.3 Da    PI: 8.95
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G032100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.64.6e-1279136562
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                         ++ rr+++NRe+ArrsR RK++ +e+L++ v  L  eN++L ++l+ l  ++  +k++
  Gorai.003G032100.1  79 RKRRRMISNRESARRSRMRKQKHLENLRNQVNRLRIENRELNNRLKFLLYHCHCVKTD 136
                         5789**************************************9999888888776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.3E-1072127No hitNo description
SMARTSM003384.9E-1475139IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.01377126IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.3E-1179129No hitNo description
PfamPF001702.7E-979136IPR004827Basic-leucine zipper domain
CDDcd147023.36E-2080131No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MSFTIPAGFS SDSMVDFDQF TGFETGFTPW DCSELFPPTT QSMEPAGSGS GSDETNQNQT  60
NSSSSLDQPN QLVSVIDERK RRRMISNRES ARRSRMRKQK HLENLRNQVN RLRIENRELN  120
NRLKFLLYHC HCVKTDNDRL RSEYSILRQK LSDIRQILLF KQLQQYSSAW PCYNVATMSD  180
QIPSLTT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17882RKRRR
27899RKRRRMISNRESARRSRMRKQK
39198RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5847428e-92JX584742.1 Gossypium hirsutum clone NBRI_GE18127 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469668.11e-138PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0D2QF141e-138A0A0D2QF14_G
STRINGVIT_00s0541g00020.t011e-62(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.11e-28basic leucine-zipper 5
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]