PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G240500.2
Common NameB456_002G240500, LOC105786349
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 423aa    MW: 45995.5 Da    PI: 8.9229
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G240500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.34.5e-15337385553
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN+ Lk+ l el+
  Gorai.002G240500.2 337 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKQENTHLKQALVELE 385
                         79****************************************9998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-12333394IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.519335387IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.1E-14337390No hitNo description
CDDcd147071.17E-23337391No hitNo description
PfamPF001706.9E-12337389IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.19E-10337386No hitNo description
PROSITE patternPS000360340355IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MVVEDSEVGE VESTLKEVDQ QLKNHPLSAL GRQSSIYSLT LDEFQHTLCG KNFGSMNMDE  60
FLTSIWNAEE NQATNSINNN HHNNGVNEQV SNHVNLSLNE TASSKGVARQ SSLPRQGSLS  120
LPAPLCRKTV DEVWSEIHKV QQGQGQSNNS NVQNAENTST RQPTFGEMTL EDFLVKAGVV  180
REPCVPPAVP PHSQHQQQFG LHQASNNPAV GPSFVPRPIM GMGGSGGFGG STYQTMPPSG  240
VLGDSSRYLN DGKGGGGYQP AAAPPSTAIC YNGKVGAAGG FGPGQAMGVV SPISPVSPDG  300
ICTNQVDNAA TQFGIEIGGL RGRKRIIDGP IEKVVERRQR RMIKNRESAA RSRARKQAYT  360
VELEAELNQL KQENTHLKQA LVELERKRKQ QYFEEWSMKT QTKAQKVKEK LRVMRRNLSG  420
PL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468185.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2
SwissprotQ9SJN01e-125ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A0D2QI930.0A0A0D2QI93_G
STRINGVIT_08s0007g03420.t011e-145(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-112bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]